Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
20500 OLYMPIC PL_BLD2081_2026
1 n NOTICE TO PERMITEE AND/OR OWNER ❑ PARTIAL APPROVAL n CORRECTIONS REQUIRED ❑ DO NOT OCCUPY 0 APPROVED PERMIT#: LOT#: DATE: JOBADDRESS: �Z�)j OC7 C�I�(htplc� (JI1tC• TYPE OF INSPECTION: 60A ❑ NO PERMIT-STOP WORK-OBTAIN PERMIT:AND MAKE WORK COMPLY WITH CURRENT BUILDING AND/OR PLANNING CODES. ❑ CONSTRUCTION IS NOT IN ACCORDANCE WITH APPROVED PLANS AND PERMIT -STOP WORK: MAKE EXISTING WORK COMPLY WITH APPROVED PLAN AND PERMIT OR REMOVE IT. ❑ STOP WORK UNTIL AUTHORIZED TO CONTINUE BY INSPECTOR. ❑ CORRECTIONS LISTED BELOW MUST BE MADE BEFORE WORK CAN BE APPROVED. ❑ WORK NOT READY FOR INSPECTION:$50 REINSPECTION FEE (PER IBC MUST BE PAID PRIOR TO NEXT INSPECTION. ❑ CONTACT INSPECTOR 360-403-3551 ❑ CALL FOR REINSPECTION THE ACTIONS OR CORRECTIONS INDICATED ABOVE ARE REQUIRED WITHIN DAYS OR PENALTIES IMPOSED BYLAW MAYAPPLY. FOR INSPECTION CALL: 360-403-3417 _ Z, INSPECTOR DATE lli ILDING DEPT. 0 PLANNING DEPT. CITY OF ARLINGTON CITY OF ARLINGTON 238 N. OLYMPIC AVE -ARLINGTON, WA. 98223 10 PHONE; (360) 403-3551 BUILDING PERMIT Address:20500 Olympic Place Permit#:2081 Parcel#:00847300000800 Valuation:40000.00 OWNER APPLICANT CONTRACTOR Name:SAFEWAY INC CPTS Name:Cuhaci&Peterson Name:Summit Properties Address:STORE# 1522 1850 MT DIABLO Address:1925 Prospect Avenue Address:6445 Citation Dr,Suite G BLVD#250 City,State Zip:WALNUT CREEK,CA 94596 City,State Zip:Orlando,FL 32814 City,State Zip:Clarkston,MI 48346 Phone: Phone:407-738-2998 Phone:248-625-4711 MECHANICAL CONTRACTOR PLUMBING CONTRACTOR Name: Name: Address: Address: City,State,Zip: City,State,Zip: Phone: Phone: LIC#: EXP: LIC#: EXP: JOB DESCRIPTION PERMIT TYPE: Commercial Alteration CODE YEAR: 2015 STORIES: I CONST.TYPE: DWELLING UNITS: 0 OCC GROUP: BUILDINGS: I OCC LOAD: PERMIT APPROVAL I AGREE TO COMPLY WITH CITY AND STATE LAWS REGULATING CONSTRUCTION AND IN DOING THE WORK AUTHORIZED THEREBY; NO PERSON WILL BE EMPLOYED IN VIOLATION OF THE LABOR CODE OF THE STATE OF WASHINGTON RELATING TO WORKMEN'S COMPENSATION INSURANCE AND RCW 18.27. THIS APPLICATION IS NOT A PERMIT UNTIL SIGNED BY THE BUILDING OFFICIAL OR HIS/HER DEPUTY AND ALL FEES ARE PAID. IT IS UNLAWFUL TO USE OR OCCUPY A BUILDING OR STRUCTURE UNTIL A FINAL INSPE ON HAS BEEN MADE AND APPROVAL OR A CERTIFICATE OF OCCUPANCY HAS BEEN GRANTED. IBC110/IRC110. SAL_ES TAX NOTICE:Sales tax relating to construction and construction materials in the City of r n us a ported on your sales tax return form and c ed ty o' rl' ton#3101. Signs a Print Name Date s By Date CONDITIONS Adhere to approved plans. THIS PERMIT AUTHORIZS ONLY THE WORK NOTED.THIS PERMIT COVERS WORK TO BE DONE ON PRIVATE PROPERTY ONLY. ANY CONSTRUCTION ON THE PUBLIC DOMAIN(CURBS,SIDEWALKS,DRIVEWAYS,MARQUEES,ETC.)WILL REQUIRE SEPARATE PERMISSION. PERMIT FEES Date Description Fee Amount 8/24/2018 Building Permit Fee $783.43 8/24/2018 Building Plan Review Fee $509.23 8/24/2018 Processing/Technology Fee $25.00 8/24/2018 State Surcharge-Commercial $25.00 Total Due: $1,342.66 Total Payment: $0.00 Balance Due: $1,342.66 CALL FOR INSPECTIONS BUILDING(360)403-3417 When calling for an inspection please leave the following information: Permit Number,Type of Inspection being requested,and whether you prefer morning or afternoon Kristin Foster From: Kristin Foster Sent: Monday, August 20, 2018 2:06 PM To: 'Ernestinal@c-p.com' Cc: Launa Peterson Subject: Safeway#1522 Permit- City of Arlington Ernestina, The permit has been reviewed and approved for the commercial TI at 20500 Olympic Place. In order to issue we will need the contractor performing the work. Please provide contractor's name and license number to prepare the permit for issuance. Thank you, Kristin Foster Permit Technician City of Arlington 18204 59t"Ave NE 360-403-3549 kf_oster@arlingtonwa.gov 1 Permit Information Date 8/6/2018 Permit Number 2081 Project Name Safeway#1522 Applicant Name Cuhaci&Peterson Applicant Address 1925 Prospect Avenue City, State,Zip Orlando,FL 32814 Contact Ernestina Lobo Phone 407-738-2998 Email Ernestinal@c-p.com Permit Type Commercial Alteration Site Address 20500 Olympic Place Valuation 40000.00 Status Applied Permit Issued Permit Expires Square Feet 0 Type of Construction/Occupancy Load Number of Stories 0 Proposed Use Grocery Staging Area Assigned To Launa Peterson Property Parcel Address Subdivision Lot Owner 00847300000800 20500 OLYMPIC PL SAFEWAY INC CPTS Review Date Type Description Target Date Completed Date Assigned To Status 3/6/2018 commercial T.I. 3/20/2018 3uildin In Review Fees Fee Description Notes Amount Building Permit Fee 322.10.00.001 $783.43 Buildinq Plan Review Fee 345.83.00.00 $509.23 Processina/Technolo v Fee 341.43.00.021 $25.00 State Surcharge-Commercial 386.00.01.00 $25.00 Total $1.342.66 Uploaded Files Upload File Date File Uploaded B i I 1 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington• 18204 59th Ave NE• Arlington, WA 98223• Phone(360) 403-3551 The following minimum information is required for your Commercial/Multi-Family Building Permit Application. Mark each box to designate that the information has been provided. Please submit this checklist as part of your submittal documents. Incomplete applications will delay the review. 12 One (1) City of Arlington Commercial/Multi-Family Permit Application (One (1) permit application per building or structure is required) One (1) City of Arlington Commercial/Multi-Family Submittal Requirements Form Two (2) Architectural Drawings ❑ Two (2) Structural Drawings ❑ Two (2) Structural Calculations One (1) Project Specification Manuals(if applicable) ❑ One (1) NREC Code Compliance Forms ❑ One (1) Special Inspection Requirements Forms ❑ One (1) Occupant's Statement of Intended Use Form Drawings shall be BOUND SEPARATELY BY TYPE, architectural, structural and landscape, and then ROLLED TOGETHER IN COMPLETE SETS> An intake appointment is required for all new Commercial or Multi-Family Building Permit Applications. To schedule an appointment please contact the City of Arlington Permit Center at (360) 403 3551 or by email to I acknowledge that all items designated above are included as part of this application. Received Jill. 4 REV 2015 Page 1 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington • 18204 59th Ave NE • Arlington. DNA 98223 • Phone(360) 403-3551 A. FEES DUE AT TIME OF PERMIT ISSUANCE B. CODES The City of Arlington currently enforces the following: International Codes 1. 2015 International Building Code (IBC) 2. 2015 International Residential Code (IRC) 3. 2015 International Mechanical Code (IMC) 4. 2015 International Fuel Gas Code(IFGC) 5. 2015 International Fire Code(IFC) 6. 2015 International Plumbing Code(IPC) 7. 2015 International Property Maintenance Code(IPMC) 8. 2015 International Existing Property Code(IEBC) 9. 2015 Washington State Energy Code (WESC) 10. 2009 Accessible& Usable Buildings and Facilities(ICC/ANSI 1417.1) Washington State Amendments 1. WAC 51-50 Washington State Building Code 2. WAC 51-51 Washington State Residential Code 3. WAC 51-52 Washington State Mechanical Code 4. WAC 51-54 Washington State Fire Code 5. WAC 51-56&51-57 Washington State Plumbing Code and Standards 6. WAC 51-11 Washington State Energy Code 7. WAC 296-46B Electrical Safety Standards, Administration, and Installation C. CITY OF ARLINGTON DESIGN REQUIREMENTS Design Wind Speed: 85 miles per hour(Exposure C) Ground Snow Load: 25 pounds per square foot Seismic Zone: D2 Rainfall: 2 inches per hour for roof drainage design. Frost Line Depth: 12 inches Soil Bearing Capacity: 1,500 psf unless a Geo-Technical Report is provided. (IBC Table 1804.2&IRC R401.4.1) D. PLANS AND DRAWINGS Submit two(2) complete sets of drawings and plans. Drawings and plans must be submitted on minimum 18"X 24", or maximum 30"X 42" paper.All sheets are to be the sarne size and sequentially labeled. Plans are required to be clearly legible,with scaled dimensions, in indelible ink, blue line,or other professional media. Plans will not be accepted that are marked preliminary or not for construction,that have red lines,cut and paste details or those that have been altered after the design professional has signed the plans. Please Note:A separate submittal of plans is required for each building or structure. REV 2015 Page 2 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington• 18204 59th Ave NE• Arlington,WA 98223 • Phone(360) 403-3551 DETAILED SUBMITTAL REQUIREMENTS Mark each box to designate that the information has been provided. Please submit this checklist as part of your submittal documents A. SITE PLAN—REQUIRED WITH ALL SUBMITTALS (May be included as part of the Architectural Drawing cover Sheet) 1. Drawing shall be prepared at scale not to exceed 1"=20 feet. 2. Show building outline and all exterior improvements. 3. Provide property legal description and show property lines. 4. Provide dimensions from the property lines to a minimum of two building corners(or two identifiable locations for irregular plan shapes). 5. Show building setbacks, easements and street access locations. 6. Indicate North direction. 7. Indicate finish floor elevation for the first level. S. Provide topographical map of the existing grades and the proposed finished grades with maximum five feet elevation contour lines. 9. Show the location of all existing underground utilities, including water,sewer,gas and electrical. 10. Flood hazard areas,floodways,and design flood elevations as applicable. B. ARCHITECTURAL DRAWINGS . Cover Sheet a) Building Information 1. Specify model code information. 2. Construction Type. 3. Number of stories and total height in feet. 4. Building square footage(per floor and total) 5. IBC Occupancy Type(show all types by floor and total). 6. Mixed-use ratio (if applicable) 7. Occupant load calculation (show by occupancy type and total) B. List work to be performed under this permit b) Design Team Information 1. Design Professional in Responsible Charge 2. Architects 3. Structural Engineers 4. Owner 5. Developer 6. Any other Design Team Members 2. Floor Plan a) Plan view 1/8"minimum scale. Details a minimum Y.-inch scale. b) Plans must show the entire tenant space. c) Specify the use of each room/area. d) Provide an occupant load calculation on the floor plan. (on every floor, in all rooms and spaces) e) Show ALL exits on the plans;include new,existing or eliminated. f) Show Barrier-Free information on the drawings. g) Show the location of all permanent rooms,walls and shafts. h) Note the uses in the adjacent tenant spaces,if applicable. i) Provide a door and door hardware schedule. REV 2015 Page 3 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington• 18204 59th Ave NE• Arlington, WA 98223• Phone(360) 403-3551 j) Show the location of all new walls, doors,windows, etc. k) Provide details and assembly numbers for any fire resistive assemblies. 1) Indicate on the plans all rated walls,doors,windows and penetrations. m) Provide a legend that distinguishes existing walls,walls to be removed and new walls. 3. ❑ Reflected Ceiling Plan a) Plan view 1/8"minimum scale. Details a minimum %-inch scale. b) Provide ceiling construction details. c) Provide suspended ceiling details complying with IBC 603.9.1.1. Show seismic bracing details. d) Show the location of all emergency lighting and exit signage. e) Detail the seismic bracing of the fixtures. f) Include a lighting fixture schedule. 4. Framing Plan a) Specify the size, spacing, span and wood species or metal gage for all stud walls. b) Indicate all wall, beam and floor connections. c) Detail the seismic bracing for all walls. d) Include a stair section showing rise,run,landings, headroom,handrail and guardrail dimensions. 5 ❑ Storage Racks(if applicable) a) Structural calculations are required for seismic bracing of storage racks eight feet or greater in height. b) Eight feet or less, show a positive connection to floor or walls. NOTE:High pile storage shall meet the requirements of current International Building and Fire Codes. C. ❑ SPECIAL INSPECTION 1. Where special inspection is required by IBC 1704, the registered design professional in responsible charge shall prepare a special inspection program that will be submitted to the City of Arlington and approved prior to issuance of the building permit to comply with IBC 106.1. D. ❑ WASHINGTON STATE ENERGY CODE 1.One (1) completed Washington State Non-Residential Energy Code Envelope Summary forms. E. OCCUPANT'S STATEMENT OF INTENDED USE 1. The Occupant's Statement of Intended Use form shall be completely filled out and may require the submittal of a Hazardous Materials inventory Statement(HMIS). Contact the Arlington REV 2015 Page 4 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington• 18204 59th Ave NE• Arlington,WA 98223 • Phone(360) 403-3551 The building permit does not include any mechanical, electrical, plumbing or fire sprinkler/alarm work. These permits are issued separately. Mechanical, electrical, plumbing, or fire sprinkler/alarm permits require a separate permit application and may also require separate plan review. Please note that any tenant improvement work in a space that involves food handling or preparation requires Snohomish County Health District approval before the permit can be issued. You must provide the Permit Center a copy of the approval letter or the approved plans. Contact the Snohomish County Health District at (425) 339-5250 with any questions or for more information. An intake appointment is required for all large Tenant Improvement Building Permit Applications. To determine if your project requires an intake appointment,to schedule an appointment or to ensure that you have the most current information, please contact the City of Arlington Permit Center at(360)403-3551 or by email to ced@arlingtonwa.gov. Incomplete applications will not be accepted. I acknowledge that all items designated as submittal requirements must accompany my Building Permit Application to be considered a complete submittal. REV 2015 Page 5 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community& Economic Development City of Arlington• 18204 59th Ave NE• Arlington, WA 96223• Phone(360) 403-3551 THIS APPLICATION TO BE USED FOR NEW COMMERCIAL STRUCTURES AND RESIDENTIAL DWELLINGS NOT REGULATED UNDER THE IRC. THIS APPLICATION MUST BE ACCOMPANIED BY COMMERCIAL APPLICATION SUBMTTAL CHECKLIST AND AN OCCUPANTS STATEMENT OF INTENDED USE. Name of Project Safeway#1522 - Grocery Staging Area Valuation: $40,000 Project Address: 20500 Olympic Place, Arlington, WA 98223 Parcel ID#: 00847300000800 Legal Description 20500 Olympic Place, Arlington, WA 98223 Owner: Safeway, Inc. Phone Number: 206.391.6631 Address: 1371 Oakland Blvd., Suite 200 City:Walnut Creek State:CA Zip Code:94596 Engineer:Architect- Dale Ulmer Phone Number: 407-661-9100 Cell Phone E-mail J Address: 1925 Prospect Ave - City.Orlando -_State:FL Zip Code:32814 General Contractor:TBD Phone Number:TBD Cell Phone: TBD E-mail: TBD Address:TBD City:TBD State: TBD Zip Code:TBD Contractor's License Number:TBD Expiration:TBD Contact Person: Ernestina Lobo Phone Number:407-661-9100 x2826 Cell Phone: 407-738-2998 E-mail: ErnestinaL@c-p.com Address: 1925 Prospect Ave city:Orlando _ _State: FL Zip Code: 32814 Proposed Scope of Work:lnterior remodel to provide a grocery staging area for the short term hold of online REV 2015 Page 6 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington • 18204 59th Ave NE• Arlington, WA 98223• Phone(360) 403-3551 Project Name/Tenant Safeway#1522 - Grocery Staging Area Site Address20500 Olympic Place, Arlington, WA 98223 Bldg/Unit/Suite IBC Construction Type IIIB IBC Occupancy Type Mercantile Description of Use Grocery Building Square Footage 43096 Number of Stories 1 Square Footage Per Floor_ Will there be any installation, modification or removal of the following? (Check all that apply) ❑ Automatic fire extinguishing systems ❑ Compressed gas systems ❑ Fire alarm and detection systems ❑ Fire pumps ❑ Flammable and combustible liquids (tanks,piping etc...) ❑ Hazardous materials ❑ High piled/rack storage ❑ Industrial ovens/furnace ❑ Private fire hydrants ❑ Spraying or dipping operations ❑ Standpipe systems ❑ Temporary membrane structure, tents (>200sq ft)or canopies (>400 sq ft) Provide details on any of the above checked items: Installation,changes,modifications or removal of any of the above may require additional submittals, information, or permits during the plan review or construction process. Statement of Special Inspection REV 2015 Page 7 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington• 18204 59th Ave NE• Arlington, WA 98223 • Phone(360) 403-3551 Safeway #1522 - Grocery Staging Area Name of Project: Project Address: 20500 Olympic Place, Arlington, WA 98223 _ Special Inspection Firm: TBD Address: Contact Person: Phone: Email: Special Inspection Firm Special Inspectors: The Special inspection Firm of _ will perform special inspection for the following types of work(separate forms must be submitted if more than one firm is to be employed). ( ) Reinforced Concrete ( ) Bolting in Concrete ( ) Pre-stressed Concrete ( ) Shotcrete ( ) Structural Masonry ( ) Structural Steel and Welding ( ) High-Strength Bolting ( ) Spray-Applied Fireproofing ( ) Smoke-Control Systems ( ) Other Specify: All individual inspectors to be employed on this project will be WABO certified for the type of inspection they are to perform. If inspection is for work that is not covered by the WABO categories,a detailed resume of the inspector and firm must be submitted.The resume must show the inspector and firm are qualified to perform the work and testing required by the project design and specifications. The work shall be inspected for conformance with the plans and specifications approved by the City. Revisions and addenda sheets will not be used for inspection unless approved by the City.The special inspector shall report to the City revisions that are not approved. A daily record will be maintained on site itemizing the inspections performed,for the review of all parties.Any nonconforming items shall be brought to the immediate attention of the contractor for resolution. A weekly shall be submitted to the City;detailing the inspections and testing performed, listing any nonconforming items and resolution of nonconforming items. Unresolved nonconforming items will be detailed on a discrepancy report and presented to the building department. A final report shall be submitted to the Building Division prior to the Certificate of Occupancy being issued.This report wi II indicate that inspection and testing was completed in conformance with the approved plans,specifications and approved revisions and addenda. Any!unresolved discrepancies must be detailed in the final report. The special inspector and special inspection firm serve in the role as"deputy" City of Arlington inspectors and as such are responsible to the City of Arlington Building Division in the performance of the required work. Contractor: The contractor shall provide the special inspector or agency adequate notification of work requiring inspection. The City approved plans and specifications must be made available, at the job site for the use of the special inspector and the City Inspector.The contractor shall maintain all daily inspections reports, on site,for review. REV 2015 Page 8 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington• 18204 59th Ave NE• Arlington, WA 98223• Phone(360) 403-3551 The special inspection functions are considered to be in addition to the normal inspections performed by the City and the contractor is responsible for contacting the City to schedule regular inspections.No concrete shall be poured or other work covered until approved by the City Inspector. Building Division: The Building Division shall review any revisions and addenda. Approved copies will be given to the contractor to maintain as part of the approved plan set. The City Inspector will monitor the special inspection functions for compliance with the agreement and the approved plans- The City Inspector shall be responsible for approving various stages of construction to be covered and work to proceed. Design Professionals: The architect and engineer will clearly indicate on the plans and specifications for the specific types of special inspection required, and shall include a schedule for inspection and testing. The architect and engineer will coordinate their revisions and addenda process in such a way as to insure all required City approvals are obtained, prior to work shown on the revisions being performed. Owner: The project owner, or the architect or engineer acting as the owners agent, shall employ the special inspector or agency. ENFORCEMENT: A failure of the special inspector or firm to perform in keeping the requirements of the IBC,the approved plans and this document may void this agreement and the Building Officials approval of the special inspector. In such case a new special inspector and/or firm would need to be proposed for approval.A failure of the design and/or construction parties to perform in accordance with this agreement may result in a STOP WORK notice being posted on the project, until nonconforming items have been resolved. ACKNOWLEDGEMENTS I have read and agree to comply with the terms and conditions of this agreement. Owner: Date: I hereby certify that the above information is correct and that the construction on, and the occupancy and the use of the above-described property will be in accordance with the laws,rules and regulation of the State of Washington. Applicants Signature Ernestina Lobo July 27, 2018 Print Applicants Name Date FOR STAFF USE ONLY Permit# Accepted By Amount Received Receipt# Date Received REV 2015 Page 9 of 9 e Project Quantity Item# Lawson#26247 Model Specified: CSI Section 11400 G-Series Reach-In Refrigerators/ One,Two&Three Section Models,32" Deep Self-Contained FGAside from their anodized aluminum side and interior finishes, Traulsen's G Series "Dealer's Choice" models meet or exceed the Equipped with an easy to use SERIES standard specifications and performance of most other brands top 11 o m o microprocessor I tier product offerings. Reliable,energy efficient,and durable,with control! .� s`a't&DotKi large individual storage capacities,the high quality G-Series line- Fron[&Door(sl 9 9 P d q Y up includes a wide range of one,two and three section reach-in refrigerator and freezer models,built in our most popular footprints. They are available with either full or half height doors,and the added convenience of a variety of different door hingings to choose from. In addition,each also includes a number of user-friendly features, making them one of the best overall equipment values in Foodservice Model G20010 today,and the right fit for nearly any commercial application. Model G10010 AVAILABLE MODELS Single Section Two Section Three Section I Model# Door Hinaina Model# Door Hinaina Model# Door Hinaina G10000 Half Right G20000 Half Left-Right G30000 Half Left-Right-Right G10001 Half Left G20001 Half Right-Left G30001 Half Left-Left-Right G10010 Full Right G20002 Half Right-Right G30002 Half Right-Right-Right Model G30010 G10011 Full Left G20003 Half Left-Left G30003 Half Left-Left-Left G20010 Full Left-Right G30010 Full Left-Right-Right G20011 Full Right-Left G30011 Full Left-Left-Right G20012 Full Right-Right G30012 Full Right-Right-Right G20013 Full Left-Left G30013 Full Left-Left-Left Standard Product Features Optional Accessory Kits High Quality Stainless Steel Exterior Front and Door(s) Additional Epoxy Coated Shelves* Corrosion Resistant Anodized Aluminum One-Piece Sides No.1 Type Tray Slides*To Accommodate either:(1)18"x Durable Anodized Aluminum Interior 26"or(2)14"x 18"Sheet Pans,Adjustable To 2"O.C. Microprocessor Control With LED Temperature Readout No.4Type Tray Slides*To Accommodate(1)18"x 26"Sheet Top-Mounted,Balanced,Self-Contained Refrigeration System Pans(equips one full section) Large High Humidity Evaporator Coil Outside The Food Zone • Universal Type Tray Slides*To Accommodate Either(1)18"x Load-Sure Guard Protects Against Improper Loading 26"or(2)14"x 18"Sheet Pans,or(2)12"x 20"Steam Table Full or Half Length Stainless Steel Doors With Locks Pans,Adjustable To 4"O.C. Self-Closing Doors With Stay Open Feature At 120 Degrees • Plated Shelves*(for use in lieu of standard shelving) Guaranteed For Life Cam-Lift Hinges • EZ-Change Interiors(#1,universals,universal heavy duty tray Guaranteed For Life Horizontal Work Flow Door Handle(s) slides and shelves) Automatically Activated Incandescent Lights • 6"High Adjustable Legs(for use in lieu of standard casters) Damage Resistant Stainless Steel Breaker Caps Three(3)Adjustable Epoxy Coated Shelves Per Section, *Please refer to spec sheetTR35872 for optional accessory kit details. Supported On Shelf Pins(installed at the factory) Energy Saving Automatic Non-Electric Condensate Evaporator All optional accessory kits are shipped separately for later installa- Magnetic Snap-In EZ-Clean Door Gaskets tion by others at the jobsite. Gasket-Protecting Anodized Aluminum Door Liner Anti-Condensate Door Per" ers Thermostatic Expansion V v M t�nIT Devi Pr,�v�d Q i * All models are ENERGY STAR*listed. Please refer I I lJ t11 �11V Vf 1 Refrigeration RecoveryTi es to www.energystar.gov to view the most up-to-date Stainless Steel One-Piece uver A&J&PING DEPARTMENT product listing and performance data. 9'Cord&Plug AttachedppROWE D Set of Four(4)6"High Cas rs With Loc Three Year Parts And Labo 10(aj(�pZy O Listed by Underwriters Laboratories Inc., Lrn]!Y�•I t 01MF to U.S.and Canadian safety standards and Five Year Compressor War BY C U5 Listed by NSF International. NO CHANGES AUTHORIZED tuft UNLESS APPROVED BY THE BUILDING INSPECTOR val: TRAULSEN 4401 BLUE MOUND . WORTH, �j eceive '1 Yb�8I I I if 2fl n o Project Quantity Item# Model Specified: CSI Section 11400 Specifications Construction,Hardware and Insulation Refrigeration System Cabinet exterior front,louver assembly and doors are constructed of 20 gauge A top mounted,self-contained, balanced refrigeration system using R-134a stainless steel.Cabinet sides (including returns), interior and door liners are refrigerant is conveniently located behind the one piece louver assembly. It features constructed of anodized aluminum.The exterior cabinet top,back and bottom are an easy to clean front facing condenser,thermostatic expansion valve,air-cooled constructed of heavy gauge aluminized steel.A set of four(4)6"high casters are hermetic compressor,large,high humidity evaporator coil located outside the food included. zone and a top mounted non-electric condensate evaporator. A 9'cord and plug is Doors are equipped with a gasket protecting metal door pan,removable plug provided Standard operating temperature is34to38°F. cylinder locks and guaranteed for life cam-lift,gravity action,self-closing metal, Controller glide hinges with stay open feature at 120 degrees.Hinges include a concealed The easy to use water resistant microprocessor control system is supplied standard. switch to automatically activate the interior incandescent lighting.Guaranteed for It includes a 3-Digit LED Display,and a Fahrenheit or Celsius Temperature Scale life,work flow door handles are mounted horizontally over recess in door which limits Display Capability. protrusion from door face into aisleways. Interior Gasket profile and Santoprene°material simplify cleaning and increase overall gasket Standard interior arrangements include three(3)epoxy coated wire shelves per life.Anti condensate heaters are located behind each door opening. section,mounted on shelf pins,installed at the factory. Shelves are full-width,and Both the cabinet and door(s)are insulated with an average of 2"thick high density, do not have any large gaps between them requiring the use of"bridge"or"junior non-CFC,foamed in place polyurethane. shelves"Recommended load limit per shelf should not exceed 225 lbs. Warranties DIMENSIONAL DATA 1-Section Models 2-Section Models 3-Section Models Both a three year parts and labor warranty and a five year compressor warranty(self- Net capacity cu.ft. 24.2(686 cu 1) 46.0(1303 cu 1) 69.1(1958 cu I) contained models only)are provided standard. Length-overall in. 29%(75.9 cm) 52'/e(132.4 cm) 76s/ie(193.8 cm) _ Depth-overall in. 35(88.8 cm) 35(88.8 cm) 35(88.8 cm) Depth-over body in. 32(81.3 cm) 32(81.3 cm) 32(81.3 cm) Depth-door open 90'in. 57s/(146.3 cm) 57%(146.3 cm) 57s/(146.3 cm) I Q Clear door width in. 21'/a(53.6 cm) 21 A(53.6 cm) 21%(53.6 cm) Clear half-door height in. 27'/z(69.9 cm) 27/z(69,9 cm) 274(69.9 cm) ] ( t Clear full-door height in. 57s/(146.3 cm) 57%(146.3 cm) 57s/(146.3 cm) i f� Heiqht-overall on 6"casters' 83'/a(211.5 cm) 83Ya(211.5 cm) 83/4(211.5 cm) No.Standard Shelves 3 6 9 r 6 Shelf area sq.ft.' 18.8(1.75 sq m) 34.6(3.21 sq m) 51.9(4.82 sq m) g ELECTRICAL DATA Elevation Elevation Elevation Voltage 115/60/1 115/60/1 115/60/1 One-Section Two-Section Three-Section Feed wires with Ground 3 3 3 Full load amperes 5.8 7.4 8.4 REFRIGERATION DATA Refrigerant R-134a R-134a R-134a s zq p s-e m] [1324 ml P.BTU/HR H. 1520(/s HP) 2240(h HP) 4610(/e HP) 24'6!2c.n1l SHIPPING DATA Length-crated in. 35(89 cm) 63(160 cm) 91(231 cm) c, Depth-crated in. 43(109 cm) 43(109 cm) 43(109 cm) '- Height-crated in. 83'/z(212 cm) 83'/z(212 cm) 831/(212 cm) Volume-crated cu.ft. 71(2011 cu 1) 131(3711 cu 1) 189(5354 cu 1) 218 141.eae! Net Wt.Ibs. 305(138 kg) 450(204 kg) 610(277 k ) Gross Wt.lbs. 395(179 kg) 590(268 kg) 790(358 kg) NOTES 7td(53Aan) r tte NOTE:Figures in parentheses reflect metric equivalents- 1= Figure shown reflects the area of standard shelf compliment plus the additional storage area available on Plan-One-Section Plan-Two-Section the cabinet bottom. 2= Based on a 90 degree F ambient and 20 degree F evaporator. For remote data please refer to spec sheetTR35837. 3= 12"Top clearance preferred for optimum performance and service access. 35" [-3Y(/3.3aro� 74 1193.acm1--i 21 (536cm] Equipped With One NEMA 5-15 P Plug _ a; 3Ccs -1 ; NOTE:When ordering please specify:Voltage,Hinging,Door Size,Options an¢,a[ny,go."n4l warranties. Plan-Three-SeC ion Continued product development may necessitate specification changes without notice. Section-All Models Part NO.TR35787(revised 7/13) RAULSFN 4401 BLUL MOUND RD. FT.WORTH, '0 1 Project Quantity Item#Lawson 54326 Model Specified: CSI Section 11400 G-Series Hinged Glass Door Reach-In One&Two Section Models, 32"Deep Freezers/Self-Contained Aside from their anodized aluminum side and interior finishes, GTraulsen's G-Series"Dealer's Choice"models meet or exceed the Equipped with an ^ '?�s SERIES standard specifications and performance of most other brands top tier microprocessor easy use product offerings. Reliable,energy efficient,and durable,with large O®O %///� srainiss swi controls 1 Fr.ta o„N,i individual storage capacities,the high quality G-Series line-up includes a wide range of one and two section reach-in freezer models,built in our most popular footprints. They are available with full height doors. In addition,each also includes a number of user-friendly features, making them one of the best overall equipment values in Foodservice today,and the right fit for nearly any commercial application. AVAILABLE MODELS Single Section Two Section Model# Door Hinging Model# Door Hinging G13010-023 Full Right G23010-023 Full Left-Right G13011-023 Full Left Model G13010-023 (shown with right-right hinging) Standard Product Features Optional Accessory Kits High Quality Stainless Steel Exterior Front Additional Epoxy Coated Shelves* Corrosion Resistant Anodized Aluminum One-Piece Sides No. 1 Type Tray Slides*To Accommodate either: (1) 18"x Durable Anodized Aluminum Interior 26"or(2) 14"x 18"Sheet Pans,Adjustable To 2"O.C. Microprocessor Control With LED Temperature Readout No.4 Type Tray Slides*To Accommodate(1) 18"x 26"Sheet Top-Mounted, Balanced, Self-Contained Refrigeration System Pans(equips one full section) • Large High Humidity Evaporator Coil Outside The Food Zone Universal Type Tray Slides*To Accommodate Either(1) 18"x Load-Sure Guard Protects Against Improper Loading 26"or(2) 14"x 18"Sheet Pans, or(2) 12"x 20"Steam Table Full Length Hinged Glass Doors With Locks Pans,Adjustable To 4"O.C. Self-Closing Doors With Stay Open Feature At 120 Degrees Plated Shelves*(for use in lieu of standard shelving) Guaranteed For Life Cam-Lift Hinges EZ-Change Interiors(#1, universals, universal heavy duty Stainless Steel Vertical Door Handle(s) tray slides and shelves) LED Lights With Exterior Switch 6"High Adjustable Legs(for use in lieu of standard casters) • Damage Resistant Stainless Steel Breaker Caps Three(3)Adjustable Epoxy Coated Shelves Per Section, *Please refer to spec sheet TR35872 for optional accessory kit details. Supported On Shelf Pins(installed at the factory) Energy Saving Automatic Non-Electric Condensate Evaporator All optional accessory kits are shipped separately for later installation by • Magnetic Snap-In EZ-Clean Door Gaskets others at the jobsite. Anti-Condensate Door Perimeter Heaters r, Many Traulsen models are EPA Energy Star listed. Please refer Thermostatic Expansion Valve Metering Device Provides Quick to www.energystargovto view the most up-to-date product listing Refrigeration Recovery Times 01= and performance data. Stainless Steel One-Piece Louver Assembly • 9'Cord&Plug Attached ON NSF Set of Four(4)6"High Casters With Locks �5Three Year Parts And Labor Warranty Five Year Compressor Warranty Intertek This unit is listed to UL 471,CSA 120 and NSF byan approved NRTL.Consult the factory or unit data plate for approval information. Approval: TRAULSEN I— 4401 BLUE MOUND a Project Quantity Item# Model Specified: CSI Section 11400 Specifications Construction,Hardware and Insulation Refrigeration System Cabinet exterior front and louver assembly are constructed of 20 gauge stainless A top mounted, self-contained, balanced refrigeration system using R-404A steel. Cabinet sides(including returns)and interior are constructed of anodized refrigerant is conveniently located behind the one piece louver assembly. Itfeatures aluminum The exterior cabinet top,back and bottom are constructed of heavy gauge an easy to clean front facing condenser,thermostatic expansion valve,air-cooled, aluminized steel.A set of four(4)6"high casters are included. hermetic compressor,large,high humidity evaporator coil located outside the food Doors are equipped with removable plug cylinder locks and guaranteed for life zone and a top mounted non-electric condensate evaporator. A 9'cord and plug is cam-lift,gravity action,self-closing metal,glide hinges with stay open feature at 120 provided. Standard operating temperature is 0 to-5°F(all models are-10 degree F degrees.An exterior mounted switch is provided to operate the interior LED capable in up to 90 degree ambient. lighting. Each door includes a vertically mounted stainless steel handle. Controller Gasket profile and Santoprenel material simplify cleaning and increase overall gasket The easy to use water resistant microprocessor control system is supplied standard. life.Anti condensate heaters are located behind each door opening. It includes a 3-Digit LED Display,and a Fahrenheit or Celsius Temperature Scale The cabinet is insulated with an average of 2"thick high density,non-CFC,foamed Display Capability. in place polyurethane. Interior Standard interior arrangements include three(3)epoxy coated wire shelves per DIMENSIONAL DATA 1Section Models 24%ctton Model section,mounted on shelf pins,installed at the factory. Shelves are full-width,and Net capacity cu.ft. 23.4(6631) 46.0(1303 1) do not have any large gaps between them requiring the use of"bridge"or"junior shelves." Recommended load limit per shelf should not exceed 225 lbs. Length-overall in. 29'/e(75.9 cm) 52'/e(132.4 cm) Warranties Depth-overall in. 35(88.8 cm) 35(88.8 cm) Both a three year parts and labor warranty and a five year compressor warranty Depth-over body in. 32(81.3 cm) 32(81.3 cm) (self-contained models only)are provided standard. Depth-door open 90'in. 57%(146.3 cm) 57%(146.3 cm) Clear door width in. 21 A(53.6 cm) Mee(53.6 cm) Clear half-door height in. 27%(69.9 cm) 27Z(69.9 cm) Clear full-door height in. 57%(146.3 cm) 57%(146.3 cm) Height-overall on 6"casters' 83'/a(211.5 cm) 83A(211.5 cm) zv7/a•Usea1 No.Standard Shelves 3 6 241re ld3 9 mt 52 ua nag.=mi Shelf area sq.ft.' 18.8(1.75 sq m) 34.6(3,21 sq m) ELECTRICAL DATA „,/a 11-2,=ml Voltage 11516011 115/60/1 Feed wires with Ground 3 3 9 m Full load amperes 9.7 11.2 ,L REFRIGERATION DATA n erieos<m - �r ve Is��on Refrigerant R-404A R-404A BTU/HR H.P.2 1500(Y2 HP) 2970(%a HP) SHIPPING DATA W leea`m --37 M2s<m Length-crated in. 35(89 cm) 63(160 cm) i I Depth-crated in. 43(109 cm) 43(109 cm) E Height-crated in. 83%(212 cm) 83Y22(212 cm) Volume-crated cu.ft. 71 (2011 cu 1) 131 (3711 cu 1) Net Wt.lbs. 320(145 kg) 650(295 kg) Gross N.lbs. 410(186 kg) 700(318 kg) E V NOTES " — NOTE:Figures in parentheses reflect metric equivalents - 1=Figure show reflects the area of standard shelf compliment plus the additional storage area available on the cabinet bottom. 2=Based on a 90 degree F ambient and 20 degree F evaporator.For remote data please refer to spec sheet TR35837. 3=12"Top clearance preferred for optimum performance and service access. — \ II ( g9uipped. - 1P Plug. o (one&two section models only) NOTE:When ordering please specify:Voltage,Hinging,Door Size and Options. Continued product development may necessitate specification changes without notice. Part No.TR36020(REV.06-26-17) TRAULSEN MI BLUE MOUND RD. FT WORTH, 1. 1 W yyI a Y w z LO x CL ^ G ICON N O 6 Ul J3 2q O^ Q r8G a' U ZrW l� Y W �Q••W C3 r WJ J a w� oaoF o Z aa� JQ ¢ bcn rx rya rc� Q q ao co p� Wy LI m HO W 3d' r �T QD qw fag z O a S d Y LL> a fag a NqW aKf]� ..0 S 6 2 �r W y qN Oq ¢ 0 d O d' U J o ¢U U J W xJ r p _ d r OJN WQ XZR r K ¢ U aq NO r }� Q = U GNN .U.HZ6 ¢jrz. 3pj Z W Jdr' ¢ Ll1 Wx J 0¢C W' N g til q ¢W Q'""'Q KEY = Na Q Y JZ � y OCO WO Q W C �QO S3vriKU r�O H z� VI N Q QU �a Sr N C3 Q< 3 S W U QSO �J Wz gWSJ Q �O q f]J J wa rz yLa cZ Q rOf (n rq W¢YJW Srr Jw rr aQ z O iA¢W.Z. ZD 'wz GED q 2 ZaCW Q WJ^ Fi d'QOU ?S-z- EE d7 W qO .U.� aW d 3S Qz ZW W y HQ O W .1�.�" 2JViQ .WQYz OW22U IzO d'I K TZ �W �xA r1Q Vl gfq JLL 2 d N ¢ ~ �dN UJW I N NUKV\Q oRaa r 2 d'J Wr z N OaZ^ ¢ L y r 2 NO. ZL, Q¢iW QSNRJOY ti WW Z� Q La 0-�q;2 O rqY JH} a J�W..OwJWSNNr Nr Z>N ¢ d ZZW 17 H F OO JWU J..U3� JN UW..SFWNd' ¢ I� QPO 04q UU¢NW MJ Q N A H U1 YY,W SWWZZ =�WWV31 dQ'332QW m L w <M Z aQ 2Uq rr.Ur J QNr NA��0 N RPJ4RfdNrlJ'JU ¢ Z Y WM rl7q 3N O y OC q WNWrr WgJWJ�K}�^^ Y f Ud dJ J NO2 J W d Rl3W L7 E.-i0 l'1 r mm I Wd WQ m WU rWW J d ¢ Wr QyWNS Q�UQWOQ�X.v,D W J Jm K2 ¢ SU^S..J> Jd'Z 2m m Y JURIUJ Z Q WN dN U r6 3rW QO N N Jd'� UOgdq U Ydz U' W DQp QOr I z Qz LWzgRWPPP PO WZS aRNV7Q adYau-m.--- "" N 6 O I!) .0 I-z m q UF7Q q Z QX< l Vl O a'f�Q I y W U O A W Q \ J o W >>1:1 N ��,j L)rOL7 .0 l7 Vlv W q W W 'o 67 W y OC y S W N \n 3: Ln w \ K >0 _� x W m �I� Nu P v N W �o � 2. 06 O�V 7 NUJ �0 rR�O j a W JW I a �O�+N w J a�'w t< W W Co oy c� Z W Lj w LLJ U a'a'i--�W I P W W ^Z0 W w =OT UO Kp ZVV))LLD(4 J Yv Q N aZ .\-I� cu, 0 W O �Z` = W I O �1W7 PA C3 ~ _ > �OLn J q Z W 3 A U ¢ W 3 ¢ w m L W Z W CU U f W w LJ7 W ¢ I q Q U Z Oe I\ 7 J LJ U J J z W Q w W _ �K F3 W F L� o¢ J N A W Z !7 L: J v F- r �t a O Z N NU f----- Z y ,F w.Lj C3 P H ; I\ V1,WZ O > ,Jn o 0 ¢In}� u W W a U P4~ -I J W U U KLo Q¢Z w z — X U>L,j N 7 0� V W W,N.�.F- Z W E W 2 A ~ J X � .AW. r w w J n0 M C 4� w v m o o= aff v 5 2 N r Lj r L J(U a 0�� �a'- jj Z v W Vl Ol •- j 906®0 W a 0 Y m Z6 u N w LLJ q u Ci O W Z Z w I p Wp(Y p O> W JN N ~ p J��C7 H L� Q r0qq<�� �' fwJ H�{{.�q/ q l7 Y W �Q.Z.W w p *$ LLJ QR .i.. =l<. OC a.Z7 p Z Q Q ma 6� w }' W Ga z JQ a ;ti " = aka n a r za a at y v ^W,,\ > >y¢ Z yN• �a�'s � o w 3o a m Qpx O/ oe OUR 0 NqW p�KI vu a. 0 Q O Qu u J WN J p [�pJJf~/i wQ 694 q ti OC =02 Q u Z OCW Np H }� Q =FU CgNN 1=1-Z¢ Q "' 3L^ ZQZ m Q p a>Wx J o<c U H OC 1--i q <Q.u. OC Il 2 NQ Q y J2 p N OCp Np < W ¢ �CL z .y.^a 0�/ l7ZK qyj~~O ~�LLpii U 2� N ¢ <oU ~ pa S~ rxn 3 2>w � 'z< pJJNwVI WG j a op y p"�� q q Vl Wd rl.� y W zcc� 6 �p�' (� q q �Q}>W pry JU tir J 6 W Z<¢ Z p mQ wz ZO p ¢ G� q 2QZ A WJz q0:<pU ? \?aiW dQ W GQ p w� d� rW¢Z 22 OG N d O N I A Y2 y F- U pW Q 3x < W W W �O 2 K vU�;' Z lJ7�J JjWyW �fiKr\Q oFlad 1�,Z x >2'J lid 2 N~o�z•�•'�"¢ LLJ N F rwmm ~2 v0N -.Pqu,R' Qyyytt..,xrW¢SJgOFW a N yW pp ��aj�gq m F WOZ G ow J"ZNaO JW_OU W.J.2FWVl OC w JQm pm H UU<N Iw-a Q n- a G pJQ aJ ¢ R' 3¢3..R'v)¢ q �q Hw L7 QZ I' N Q 2U� I!7 QF� SxN L7 LW'JZZ N�q JNOC�NI=-JJ Z 22P O'm X aq HUq�N K N ne m WNWE W q.Z.QW�.W.y• l�U x ud dJ J 0M xWq 3.a m3W L _W.~.p l7�yrwt�Ja�p�p.���mm 1• 7 WI WQ m wU HWW Jw d U¢WLIu •6� J JU OCx Q 2U 2..J> 7 < JK2 Yd' pz Yl7 x 6 WN dVl u rQ 3�w Qp N JUmUJ N JK� Up Gllq U ra2 U• W �¢0 6p�lz aZwwooa U, iq wzx 4gV)IIIQ aaYOC U- VI.. S "' w m < Ln 'U N 60 Y W q Uqp \ q z < OC J N ❑ N Z W w O p OR< II J > ;P p W ❑ vi »yam, HOq U =ZOQ L7 V)v W \ Ww U n q m m N \ O Nmv �.vr w a La > r o =�� x U W (u(h N y � I N W QOq flJ F7 J o0�++0 L�Zo W I- 3� C`7 vm ❑ N YJ m ri�� w JJJWr \ Qv� p�v P17 J 64m w W W W W I.q <}Q� >~M ❑} v va Z_ W W.~-iZS Z W ❑ z ❑N IW- L.� d H O y N z U Q N ¢ } ❑ WM z V)L7 0 W O Y ❑Y NN U W a o J U Q w z 0 W I O LW7 O wo o � > �q W< O -j f A H H Cl� �z L(� J w 3 A U ¢ w J L— 3 ¢ W J L7 J W h Z W (U U J W Z f \ W Q u z d C/) zo(4 Cj I V) W W 2 J q J J z < l7 W v~ p w = W H _ LLJ a J H Z00 t< J ..r W z OZ Cu u r---- Z N 2: \ w=i o 0 W V, Q A J o W w N O W W a. U N U U W L7 _ u>(u ? w W N N W tiEl z w r W x H W "J" W W q r J C O L N ❑ ❑ _ s In d ❑ u= Li Y f'1 W < C Of H W >' J. > W 2 ❑ H i u, 69e6a w a V) Lozier I Wall Section https://Iozier.com/products/gondolas/wall/wall-section/ You are in: Lozier > Products > Gondolas > Wall > Wall Section Wall Section Part Number:WS A shelving run consists of multiple Wall Sections combined with one Wall End Unit. Product Details: INCLUDES • 1 Uprite • 1 Base Brackets • 1 Base Decks • 1 Closed Base Fronts • 1 Top Rail • 1 Center Rail (2 on 96-144"H) • 1 Bottom Rail • 1 Splicer Rail (78"-144"H) • Back Material DIMENSIONS UPRITE HEIGHTS UPRI FE: DEPTH: 2 10" 120" 1 14" 1081, 102" 96" 901, 8 4" 78" 72" 66" 601, UPRITE DEPTH+ DECK DEPTH ^ 611 1911 '12t' 2311 511 2811 31 II 34" �(A}1t 7 LL 3 G L'€3 48" ~ 42" 36" BASE HEIGHTS: I ► d"I (5'IANDARD 06 BASE) 6"(LOW BASE) NOMINAL (CENTER TO CENTER OF UPRITES) SECTIONS WIDTHS: : : : : BASE DECK [DEPTHS: 24", 36' &48" : : : ' 13" 16" 19" 201E 22" 25" 28" 31I. OVERALL RUN LENGTH TOTAL NOMINAL LENGTH + 2" : : BACK OPTIONS Pegboard Marteck Peg Mirror ,!01 Peg Wood rain l ` I'I' 110 Woodgrain Slotwall w/ Inserts Slotwall Econo Marteck Product Options and Numbers Example Part#: WS 4 54 19 06 S CBF CHR PLT PLT P PLT S N PLT Wall Section: WS Section Width: 2', 3', 4' Height: 36", 42", 48", 54", 60", 66", 72", 78", 84", 90", 96", 102", 108", 114", 120" Base Deck Depth:13", 16', 19", 20", 22", 25", 28", 31" Base Type: 06, LB Spring Locking Base Bracket: S Rail Type: T,Omitfor regular rails Base Front: CBF, OBF Base Front Color: CHR Uprite Color: PLT ,Optional Catalog Colors Back Rail Color: PLT ,Optional Catalog Colors Back Material: P, M, S, SI, ME, W, PW, PM, NBR Back Color: PLT ,Optional Catalog Colors Deck Type: S,HDSD Deck Molding: N, M13S, M13G, M55S, M55G, M35S, M35G, MR1S, MR1G Deck Color: PLT ,Optional Catalog_Colors 06 -06 Base (8"H) LB - Low Base(6"H) T -Telescopic Rails CBF -Closed Base Front OBF -Open Base Front CHR -Charcoal Black PLT - Platinum S -Standard Deck HDSD - Heavy Duty Deck P - Pegboard M - Marteck S -Slotwall SI -Slotwall with Inserts ME - Econo Marteck W -Woodgrain PW - Peg Woodgrain PM - Peg Mirror NBR - No Backs or Rails VINAVA s i N - No Molding M13S - M13 Satin Molding M13G -M13 Gold Molding M55S -M55 Satin Molding M55G - M55 Gold Molding M35S -M35 Satin Molding M35G -M35 Gold Molding MR1S -MR1 Satin Molding MR1G -MR1 Gold Molding yy€, tppNy S o00 8 a� 57° �xxry.�« O F Y • JU' v o�U� ��g8g`_o zv � �" �LL �8 (gg$�� M 2 � L_' P �� �n-< '� g u � t ^ as 5 Z 0 Zorc fm • ��� LJJ O �"� ❑❑❑� 9 U N J N Q �U m W W H O � LU C+ 00 .J H cn U �JG G LU U ag x U Y� o tu—cN Y Z V H J U O =J V) i Oz j �U m� u� G w � •� 0 Z . . - gR a R > M ml oo ° P. ai Sr • 8` �aLa` zv �" 3 Y o i`i o W In m . J W L_ N N LL .... W NN Q ^ m V1 w iY N ^� � �� �� _ u 08 N y � m� Wf7 C.Jm N O T-II -40 ui _ I I LU w _ O U PO u a� 10-1 W m cy') !d®/ 2#■ �\ 2Q�a @ ! 7\ zƒ n � §2 q L/ . e (� z 4m \\ k �( )\ =r §� k/ k 2 @® ,a �\ 4 E/ /© >- - ■Lu\ / . e �; � �. 1 r z F c x f SAFEWAY # 15 2 2 0) uj } LL Z O Q Q a °W �z� { Oo� �U U 20500 OLYMPIC PLACE °m° 4 � uJoa w Co V W ARLINGTON , WA 98223 � a�a p � N � N ARCHITECT STRUCTURAL PROJECT SCOPE a T- Lu PROJECT CONSISTS OF CREATING A GROCERY STAGING A ENGINEER }¢m AREA FOR THE SHORT TERM HOLDING OF ONLINE Z a GROCERY ORDERS PRIOR TO PICK UP BY CUSTOMER Q U a I j CUHACI&PETERSON CUHACI&PETERSON THE RENOVATED AREA HOUSES REACH-IN a w 550 TOWNSHIP LINE RD,STE 600 1925 PROSPECT AVENUE REFRIGERATORS,REACH-IN FREEZERS,SHELVING,AND A >w O BLUE BELL,PA 19422 ORLANDO,FL 32814 WORKTABLE FOR ORDER TRACKING NO CHANGE WILL i Cf w 00 m BE MADE TO THE EXISTING CEILING.LIGHTING,HVAC OR U o Z LLl PH:(215)641A830 EXT 5215 PH:(407)661-9100 EXT 2451 w o Q�K ] SPRINKLERS IN THIS AREA WHICH WILL REMAIN AND I CONTACT:BARBARA HOGAN CONTACT:BRETT RYLANDS SERVE THE STAGING AREA NO HOT FOOD WILL BE z a(D < w OU STORED IN THE STAGING AREA ALL FOOD IS PACKAGED € a NO FOOD PREPARATION WILL OCCUR IN THIS SPACE 4 -- � ARCHITECTURAL STRUCTURAL AO COVER SHEET S1 ENCLOSURE FRAMING E ¢S ?p F 1 1;�t,11 u,l•t I{ �n." w a - - ` r --- —�f Al EQUIPMENT PLAN,NOTES, CODES r DETAILS,AND SCHEDULES •Yy7 BUILDING: 2015 IBC _ ELECTRICAL 2017 NEC F �-- T I ._-; -+< PLUMBING: 2015 UPC I + IBC INFORMATIONOFFICE COPY USE GROUP: M'MERCANTILE rl J I I CONSTRUCTION TYPE: IIIB GROSS BUILDING AREA: 43,096 SO.FT PROJECT AREA 238 SO FT � CITY OF ARLINGTON �� -- - o BUILDING DEPARTMENT APPROVED DATE 97 8Y a $ c w Received1522 m 1 NO CHANGES AUTHORIZED i•. UNLESS APPROVED BY THE ARLINGTON,WA JUL0 2.018 BUILDING INSPECTOR �1� 17 f,\% I SAFEWAY0 NEW GROCER' AREA OF WORK STAGING ARE; - — — LEGEND GENERAL NOTES DSINGWALL 1 INSTALL ALLWORKINACCOROANCE WNH ALLCODESANDAS PER WWUFACNRERSWIiTFlFN WSII4UCTKYIS 4A`lTNR O . �� MAMIFACNRFITSSPEOFlEOf1FARAYCES FOTALLEWPNEM p ' ---- NFWPARTIALHEIGMTWALLWI IV1 GWB BONISNES SEE SHEET St 2 COERNACTOR S RESPONSIBLE FOR VFNNYIRG ALL OMENSIONS SIIOND ON ORAWNGS AND TO NEPONTAM WSCREPANCES TO +1 RELOCATE EQUIPMENT-� - -0-1-SEE DETAII3'A+. ARQNIECTANWRSAFEWAV REPRESENTATIVE 9 EQUIPMENTNUMBER SEEEQUIPMEMS❑EDULE DEMOLITION NOTES x N o ' ~ REMOVE EQUIPMENT 1 VEgVYIXTEMOFOEMODIIXNWSAFEWAYREPRESEMATNEBEFORECOMUMNC / I REMOVE EQUIPMENT J PATCH,R'_PWR,ANl10LEANRODRSANDWMLSTOLNILHEJt611NG p' s W V R - - ) VEREYp590511DNOFREMOVEDEWAMIEENNRAFEWAYREPRESEMATNE 3 J 1 GENERAL ELECTRICAL NOTES F v REMOVE BUMPER-•. ALLWIgWG NYLL BE RUN IN NLTALLIC CONWrt.C014CEu W WALLS B CRILVGSIN FNMIEDMFAS MCCAMEMAY DE WR' _ ._ ,� LONCEALEDABOVE CUIRMiS O4W WMlBVAEAE htlTSUBECTTOPHYSPALWML>- '/1 � �V'^ 2 ALLEDUIPMFNT SHALL BE INSTALEp Np NEAT AND WORIDVVUME MANNER PAPA11CLt PEMEWIIUIIMIO BULOWG STNUC111RE 3 MINMIMC MPSNESWILWM',MW SNMEOOIEEAYIISE MIMWNMDUNE 512ESNAl:BEl12AWGTHRYIMVN TYPE,UNLESS _ NO1EDOr11FNWIY ALLWWNGTOBECOPPER ALMRESIlE3NONN ONINE ELECOiMA:EWIPMFMNDTESAAE kf1ENDE➢TO BE . TXEMMNUNACCFPTABLE WNE512E 1 -WORKSHAIISEDMEWACLORDMICEWIIHTPFNEC INFPA A1201T.TElAIFS/GTATECDD�,AMIIOLK CODES .LL:ELECTWLALEfNB9AFUL-CLUOLVG BUTNOTQYDEOTOCONOIIR.VAflE,BOxES,MA F1TlINGS,SIULLBENIW ANO FREE JF �1 � UFFECTS SILYiBE/JITNE U:EABR,ANO SHRLLAEETAYWAANO ANSI STAEDpIDS \` RELOCATE / 6 ALLWORKAND MATERMLSS BEGUARWIEEDFMEFROLIDEFELTSEORAMWWIAIPEDNIDOFW"UNLEESti TED N REMOVE EQUIPMENT OTIERM- DEMOLITION PLAN T THECO:ORS OFMLRECEPTACLESAND DEVICE PlA1E5G""LAM'LH°IISTNG ` 'y SCALE 1l4'=1'-V J1-I," S CM CTDRTOVEWFYTNATMOPRRNE GDOIWONH d4ANYDTMRMFCAMWCALISiWBNGEWIPLENFSRUNDNECPYASOVE _ Al L�1 ALIGN NEW WALL /. - — / FIEC RALPMTi.S OVC We EXISTING SOFFIT 1 ��^'1 E WNEAE IXISTWGEWPNFNTGSNOWNTOBEREIOCFIEO FLECR11CAl COW1UCTORSIWLLPROWOENi�ND'Jrt,JWLTNM'BOXES ' �\l WRN — -- - ' CABLE iACCESSaDES AR REWIREOTO REWSE EKI91R1GCNQIIIINGTO ACCOlM100.41ENEW LOGTAIIOFEIXARAENI ' f0 F1ECIRILR:LONIRAI:TOR TO VERIFY ININE FIELDAILRECEPTACLESdJUNCTNN BOEESTOBEIE1kFDOR RRUgTE NDFLOROWO.Y YID C_J O �� SHOIILO BE PAICIEO i11511 WTD1ANTFpMLTR O�IEATW EJpSING�JUNCTMIN BO%NCTWIA�SIgW➢BE REN.OVEO,P.W FLOOR cc h W 11 VERIFY A'..KDRKTOBE DONE WRH SAFEWAY REPRE�lTDNEBEFg1EPA0CEFDN4G ! 1 RELOCATED �46 _\ S 1F ElEC1RIC/.LCONNACTDII ISTO PROVIDE GFl RIOIELTL'1N FOR EOIIPEIENTRECEPTACIFS P[RTE LIWRENIELEC110.:CD0E w EQUIPMENT,SEE AT 41I $ W ELECTRICAL NOTEI ~ L„ WORN TABLE BY ^� 13 ELWTRIULCOHIMTOR SIWL FlEIDVERIFYTEEUISTWGGECIRN'.AI PAMLBTOOEINAYETNE PROPER W TKNIFONTEIE OTHERS.SEE ELECTRI IIOIE F20EIWDCER/16.L1011� NEWCNLUITS VFDIFIGrI0N51M1!I CLOE MONHONNGn T11EEJECTRILALLOADWIMWTNE PAlEL UNDER FULLLo/D TG Z Q CONFIRN SPARE CIPACNY nS WLLLASRIE PIIYSKi4 SPACETOAW BgEAlORS RELOGIEEKSiNIGBRFAAERS ASHFCESSARY OR C Q 0 OCOR POST,EACH EQUIPMENT NOTE 7. , IM GRE$.WC TO EAIAI SF VEIIE REQUIRED TOAgoolc��CORRECT.SP.IC-pgONDEMIINGCRWGgE5ULT5 TO THE BAFEWAYPRNECTMJNM£A,AND 10 THE 0_ W _ SIDE SEE�FL'p'EE .� g C '� LPL. (�Ry114* AREA U In 1 J EXIST NO LIGHT 21 �a FIXTURES TO NEW ELECTRICAL EQUIPMENT NOTES ! U>m -�,1 1 LIGHTING CONTROL CI Ci ,`� 1 MERE IXIBTNG EWIINAFNT IS SHOVN TO BE flLLOCATE4 ELECIWCAL CONRNM:TOR SNNL PflovDE ALL CONWR RDKTA'IN 0 Q V BOXES POWER POLES GABLE ND ACCESSONIFS AS REDUCED TO REVISE E%STWG GCWRNG AID ACCOMMODATE NEW Z U LOCATION OF EOUIPMFM _E FM MEN_ C J O = --- \ 2 EIECTINCRILC IXSTMG PANEL L'ONIT�BTO AN EXISTINGSPMc ffii,�BPOIE BXFN�E FIO�RCCCUO PDWRED ROTEECIDN PROVDE TYPED UIMTED Q z r rr PANRSOIEDULE FOR EMCEPANELARER YLSTAlU1DK Z O Q I I IrIr l �rl 3 LLECOIIGLCONIMCIO2 SIMLL PRMIOEFO4NEW 2-0OORflE1CNNflEFRIGF/1AT0I1 A0URFI RELEPTACIE WRHU125121N2G f m 1�0 Q Z LLL LL_LL LLLLLLL-�� WT TOENSTRIGP.Wfi OWND7TOANIX6TNG5pME III 20A,i POEBREAKER FORCNCODPROTECTION PROMOETWED. ` W_ M3 W T- r f IPOATED PANEL SCHEDULE ETAL EMIRE PANE AFTER NSTAIUTDN U Q a.HEC1RIPiLLCONIMCIORSIMRPRO MFORNEW3000RRFA"RE GEINTOR ADURF%1ECEPIACIEWIIH 11121ti,1912G IT. IrI IT. I'� L�I 3N-roE%IsiNG PANEL COMMECT TOANEDSTNSSRNR IIlM.I PDMINIILFA FORCNOIJUPR01ECIpN PROVDETYPED IFF•-� , ) �L PREL.Al. - IILL_ lL LLL� �� \.. W TEDPMELSOIEDMEFORENRREPMRAIFNNSTMIATICN r Q EOUIPMENT,SEE ) EIECIMCRL CONIRACIOI SIWLRNOJOEFM NHV I-ODOR RHIGIW FAEFhR AOURFX RECEPTACLE WIIN(II26I2 I$=3NL ■` L~ ELECTRICAL NOTE 1 2F•/' TO EXED110 PANEL CON EC TO AN FJBSTNG SPARE DI 20A 1 POE SHAKEN FOR CNCIR PROTECTION PROYDE TYPED. 1 - UPOATEOPMELSOI® EFORENICEPANELAFIERWSTAWITLOI `V EQUIPMENT PLAN L ELEC RICALCONIRACTORMILLLMR EFOKNEW20001LRFACHINMEF ADUPIE%RECEPFACLEWIM1112Al2 1E11C Y4C t N C1 TO IX911NG PANEL CO ECT TO AN ERA TN BNF IIIER CNCINI O S—(1)NA.1 POLE FOR PROIECIIDN PROVOE TYPED, I A� SCALE 114-=1'-0" UPDATEOPAMLLSOIEDWE FpI BlIY+E PNIRAFLEA WSTALLAIDN E Q F- UO i EIECTRGLLCONIIUI:TOR BIWLPROVIpE FOR NEW AGRI PIENOSERELEPE AOM GIEJ(R PTACLEWITH(112Y121012G, {e W MT TO EDSTNG PANEL OpWECTTO AN ECSIMG SPARE(R 20A 1 POLE BREAKER FOR CWCO PROTECTION PFO TYPED f K'#.W 1y Z E-ILITING CEILING UPDATED PMRSCHEOLLE FORENINEPN AFTER NSTAWIIDN F U Q N Z E%Isnnccw6wAu BOX HEADER sEEohalL `OPEN TO -EDsnncExrER10R ELECTRICAL EQUIPMENT SCHEDULE ! }a LO ABOVE WALL DESCRIPTION AMPS VOLTS PHASE CYCLE PLUG I RECEPT LDCATDN ""A"" ` Q Q U 3 d NEW AUTOMATIC RAL , F a F SLIDING DOOR W! �' AUTO SLIDER DOOR 5 120 1 60 HZ IIMDI'ICE NONE WALL 20AJIP )p Z TEMPERED GLASS z K w J I- Lu ANGLES '.yo.UTA,5' 2-DOOR REAGH411 REFRIG 7A 120 1 GGHZ 52DP 620R W'u1 20ANP U LL 0(D r CL WEDGE BOLI w O a 0 __ 0U6i0e 3-DOW REACH-W REFAIG BA 120 1 60 nz 520P 6-2OR WAIT 2Nd1P /11011A C7 ILPJ N Q Z 14OOR REACH4N FREEZER 97 12D 1 60HZ 5.20P 5-20R VM L 20NIP a Li -_ Of 2-DODR REACH4N FREEZER 112 120 1 ISO HZ 520P 5-20P WALL 20A/IP GENERAL PURPOSE RECEPT 1'. 20 -1 - - 60 HZ SHIP S2OR WALL 2OAIIF -� ! r END POST-. HOLE v EQUIPMENT SCHEDULE �J)ib NEW GWE � 3 WALL,PM '_HANDRAIL EON STATUS DESCRIPTION MANUF. MODEL NOTES A 2000NRFACNNN SELFFEWAYNED ONGUECIEBVFJOFY LOCATIFM'NEW REFRIGERATORTRAULSEN G20010WISAFEWAYREP SEEEIEDEWIP NOTE3 o3 W o 'DOOR REACHIN SELF-CONTAINED ON CASTERS VERIFY LOCATION t 4'A1N'ANGLE 4LJ W REFRGERATOR TRAULSEN G3W70 WISAFFWAYREP,SEI:..EIFC EQUIP!p¢e ` 1I1i t �`3 j NEW NFMLIL TRAULSEN 'G1301016i SELF-CONTAINEDiwsAFEWV ON CASTERS.VERIFY LOCA1Bkl tG e lOL100RBNe7POC ;4 NEW ♦2DOOR RFACRIN TRAULSEN G230IM3 SELF-CONTAINED ON CASTERS VERIFY LOCATION FREEZER W/SAFEWAYREP SEEELECEOLOPNOTE6 E C Sl N:h S'1ELVWG L02FA Wg VEWFY QUANTITY 6 LOCATION WI SAFEWAY REP HT RAILING DETAILS —' - 5'S SEEDETAiTS A'LA1A6N7 A 3 j t 2L PE MANUFAUTURE A� T OINGDTIL EGIC W A T4 C �` lE1N SLIDING OOOI4 AS.SAABLOY S150D SAFLWAY INSTALL PER MAMIFM:T1RiHC' LNI7RI NS SEE 551 fORCONN NNIECT OTL SEE ) !(EWCw BAQ EL EC EQUIP NOTE f.W C L"2� NEW WALL ELEVATION FINISH SCHEDULE FOR GROCERY STAGING AREA g I3 I Al% SCALE 12"=1'-0' ` I LOCATION STATUS DESCRIPTION � LCT CFLM CAL E1F4�1IID�C OUSTING ACOUSTI CEDING TILEMAIN F !" CON ITION,043ACN ��N� UU9gFFF 4- NONDITION,TYP.• Lam. 1YT•O IWRi, WALL E�so - lwAIWLEMM 1M1'1 C01f EASE � t ANCHOR,IYP. a-� �1 WALLiCOVEj qg UPRIGHT,TYR GONDOLA e' W� BASE NEW WASHABLE PANT TO MATCH FJUSRNG VNYLCOVE BASE i02AATCHE%LSikIG FL-o m�GONDOLAREMMIN �vlSUPPORT- + '` ❑ ❑ U m 2 UPRIGHTS=FOUR ANCHOR PLATES 4 UPRIGHTS=SIX ANCHOR PLATES Lam' rr Y 1522 - ARLINGTON,WA S UPRIGHTS=SIX ANCHOR PUTFS ' SUAB I_SEISMICANCHOR PLATE SY MAOM W! 'A J C_- 1.1 11' .rrrLL. . . '. ANCHORS SIMPSON TITER HDSCREW 1,�! h SAFEWAY0 ANCHORS W!3112'EMBFDMENT, INSTALLED PER)CC REPORT ESR-2713 '}"v" •' 1 UP�FFig•EIOM AJIC/ICAP�ATFS INI FO NATFOLSPECIALINSPECTION SEE DETAIL �� R LAYOUT l 4 GONDOLA ANCHORAGE DETAILS s GONDOLA ANCHORAGE TO SLAB DETAIL F/ e SHELVING ELEVATION uLFA xWaa �Aij SCALE3M'=1'4Y Al NTS \�ij NTS KEY PLAN GENERAL F THESE GENERAL NOTES ARE NOT INTENDED TO REPLACE SPECIFICATIONS SEE TYPICAL DETAIL NOTES SPECIFICATIONS FOR REQUIREMENTS IN ADDITION TO GENERAL NOTES 6 NOT ALL EXISTING CONDITIONS.PROPOSED CONDITIONS OR UTILITIES ARE SHOWN ON THE DRAWINGS COORDINATE STRUCTURAL WORK WITH THE WORK ONLY HERUSE TRADES INCASE OF CONFLICTTH NOTIFY THE DESIGN SCALEPROFESSIONAL 1, ALL STUDS SHALL BE 33-MIL(20 GAUGE)-33KSI UNLESS C ONLY USE DIMENSIONS INDICATED ON THE DRAWINGS DO NOT SCALE NOTED OTHERWISE. N orn oRA ELEVAINGTIONS 2. USE G40 GALVANIZING MINIMUM FOR ALL STUDS. D ELEVE➢T DATUM INDICATED ON THE ARCHITECTURAL DR ARE INGSBASED Da n 3. ALL SCREWS ARE k10 SELF-TAPPING PANCAKE-HEAD.UNLESS PROJECT DATUM INDIcaTE0ON THE ARcwTEcruRaL DRaWNcs ALL SCREWS ARE INTHE DETAILS. E 4 ED HERWISE DESIGN CRITERIA: L c �_ m i v N V 2015 INTERNATIONAL BUILDING CODE B ASCE7SERVICEABILITY MINIMUM DESIGN DEFLECTION FOR CRITERIA PER BUILDINGS ANDOTHER STRUCTURES C DESIGNS STANDARD AND DEFLECTION CRITERIA PER GOVERNING COMPONENT v. DESIGN STANDAgO C AISI FORM GO STEEL EL STRUCTURAL CTURIAL MEMBERSA AND ON 2201 DESIGN OF COLD, FORMED STEELSTRUCTURALMEMBERS ANI ANSI FOR THE 15 DESIGN LOADING: A DVE LOAD 5ELF. EIGIT HORIZONTAL B. WINDIUDOb-PARTITION 5PSF HORIZONTAL)GOVERNSJ C WWOD DEBT N WA 0 FLOOD DESIGN DATA WA E DESIGN LOAD BEARING VALUES OF SOIL NON F SEISMIC LOADING(DESIGN CATEGORY AND CLASS) RISK CATEGORY:II 2 SITE CLASS'D 3 SEISMIC IMPORTANCE FACTOR(IP1 10 4 DESIGN SPECTRAL RESPONSE ACCELERATION PARAMETERS - - - - —_ a Sus 2,09(WORST CASE DESIGN USED FORSYSTEM! j SUBMITTALS: RCAIMS S ANEFWALt (6)#12 SCiREt45 DIM FCTa� A THE SCREWS. AN SUBMITTALS ARE REQUIRED:COLD FORMED STUD CLIPS caw 3'4'.. 3' 3' ITT . SCREWS,AND ANCHORAGE ® U) W6d 5 F Z Q PDfWM61ALItUA1K110R IK01/BHIEl1F6 ® —-,�.,. `�_ �. �� a o 1 -� ! �zm TEN HD HEAVY-DULY SCREW ANCHORS-ZINC PLATED � ® � � O O B INSTALLATION SHALL CONFORM TO THE MANUFACTURERS PUBLISHED Z INSTALLATION INSTRUCTIONS WHERE HOLES ARE DRI LLED IN CONCRETE, Ln U U HOLES SHALL BE ACCURATELY AND SQUARELY DRILLEC.AND THE HOLES I —- Z SHALLSECIEANEDIN ACCORDANCE WITH THE MANUFACTURERS ^- _ 4 _ o Z Z RECOMMENDATIONS ' / (n m O C UNLESS OTHERWISE MATTE IALS USIISMNG SHALL BE INSTALLED IN HOLES y>0 a 7 T- DRILLED INTOTO ANSI 021215 USING CARBIDE TIPPED DRILL BR$ O Q CONFORMING A ANSI RRECOMM D NMERE MANUFACTURER RECOMMENDS USE OF SPECIAL TOOLS FOR INSTALLATION OF ANCHORS,SUCH TOOLS SHALL BE USED UNLESS NOTES E CO W OTHERWISE PERMITTED SPECIFICALLY BY THE ENGINEER OR ARCH ITECT 1 FRAMINGANDANCHORAGE NOT SHOWN FOR CLARITY �'��� w J OF RECORD 2 SCREW PATTERN 3 IS AS SHOWN IN DETAIL DO NOT DEVIATE /TYP EA I U Q a E IDENTIFY POSITION HOLE FOR S EXERCISE LSE CARE IN DRILING TO OF 3 CON.NECTOR SHALL BE CENTERED ON WALL FRAMING 3HB FLAMGf PRIOR TO DRILLING HOLES FOR ANCHORS EXERCISE CARE E DRILLING TO AVOID DAMAGING EXISTING REINFORCING OR EMBEDDED ITEMS NOTIFY F THE ENGINEER IF REINFORCING STEEL OR OTHER EMBEDDED ITEMS ARE ENCOUNTERED DURING DRILLING 4 N Z F SPECRACIAL KED AN UNCRCTION FOR MECHANICAL NANCHORS DANCE WIT FOR USE IN ©SIMPSON RCKW5.5 FASTENING O BASE PLATE N CRACKED AND UN SPECIAL D CONCRETE IN ACCORDANCE WITH UGC ES AC193 PERIODIC SPECIAL INSPECTION IS REQUIRED 5"=1'-D" 3" F W r 3G4Lv!R! < U N ILL PART I PRODUCTS z Q am OfLu 11 COLD FORMED STEEL FRAMING GENERAL G L)Q A GRADEA00Sn'OATING,5TRUCTUR01MIN)ETYPEHMETALLICCOATEDOF W6rb5 H �a3 GRADE ANDGOA MANUFACTURERS TAN) IM'1HICK WOOD -Y - >- 0 B STEELSINDS MED,PUNCHED,WITH STIFFD C-SHAPEDENED STEEL STUDS OF LOWE6 T®fIFOQ t �d DEPTHS INDICATED,PUNCHED,WITH STIFFENED FLANGES,AND AS FOLLOWS SHIM � �� J OF Q 1 MINIMUM BASE-METAL THICKNESS:00329 INCH _ W6. MINIMUM FLANGE WIDTH 1-518 INCHES 1 ALUMINUM DOOR A9112W6.8 L) 'Q/�p J Z C STEEL DEPTHSRDICATENUFACTURERSS LIN STRAIGHT FLANGES, AND AS OF WEB 6DOT125-33 TRACKS 1 JAB b •� O C7 AAJNQ , w DEPTHS INDICATED UNPUNCHEO WITH STRAIGHT FLANGES,AND AS FOLLOWS OF POST FASTEN wi12) 1 ap ROWS OF FASTENERS @ SIA SELF-DRILUNG �8..JF• E 1 MINIMUMFLANGENDTHIC 114INC WATCHING STEEL STUDS 12'OC.STAGGERED FLAT HEAD SCREW q5 2 MINIMUM FLANGE WDTH:1-1ld INCHES 12 FAD CATION WITH WINGS-TYPE A FABRICATE COUDFORMED STEEL FRAMING AND ACCESSORIES PLUMB- GYPSUM BOARD 410STAWlESS _ SQUARE,AND TRUE TO LINE,AND WITH CONNECTIONS SECURELY FASTENED LENGTH=31X (DOOR) m- ACCORDINGTOREFERENCEDAISISSPECIFICATIONSANDSTANDARDSAND ; EXIST A' MANUFACTURER'S WRITTEN INSTRUCTIONS MIN CONIC -. B FABRICATION TOLERANCES FABRICATE ASSEMBLIES LEVEL PLUMB AND TRUE ONIC 81 iO LINE TOP MAXIMUM ALLOWABLE TOLERANCE VARIATION OF LIB INCH IN IO NOTE BASE PLATE ;? FEET AND AS FOLLOWS 1 SPACING:SPACE INDIVIDUAL FRAMING MEMBERS NO MORE THAN INSTALL(4)#I4 SCREWS AT HEADER SPACED 1'FROA1 TOP AND 1 S ON CENTER ROUGH OPENING PLUS OR MINUS 1.re INCH FROM PLAN LOCATION CUMULATIVE ERROR PER DOOR MFR p 3 b SHALL NOT EXCEED MINIMUM FASTENING REQUIREMENTS Of FASTEN REMAINING SCREWS 24'0 C SHEATHING OR OTHER FINISHING MATERIALS MAX SPACING TyCOF51,A9 - { Irrsh 2 SQUARENESS FABRICATE EACH COLD FORMED STEEL FRAMING [t ASSEMBLY TO A MAXIMUM OUT-OF-SQUARE TOLERANCE OF 1;8INCH SIMPSON THEN ND PART2 EXECUTION impB 1 W Q 21 EXAMINATION h M A FOR CO SUPPORTING NTH UBSTRATESREQUIREMENTS TS OR INSTALLATION STRUCTURAL TOLERANCES O SLIDING DOOR TO POST CONNECTION O TYP.SLIDING DOOR POST 5 FRAMING FOR COMPLIANCE WITH REQUIREMENTS FOR INSTALLATION TOLERANCES AND 3"=1'-0" OTHER CONDITIONS AFFECTING PERFORMANCE OF THE WORK PROCEED 314"=1,-0" WITH INSTALLATION ONLY AFTER UNSATISFACTORY CONDITIONS HAVE BEEN F CORRECTED 1` 221NSTA ELATION-GENERAL A COLD FORMED STEEL FRAMING MAY BE SHOP OR FIELD FABRICATED FOR G S INSTALLATION OR IT MAY BE FIELD ASSEMBLED B INSTALL COLDFORMED STEEL FRAMING ACCORDING TO AISI S200 AND TO 6'OOT72SJ3(33KSI? I MANUFACTURERS WRITTEN INSTRUCTIONS UNLESS MORE STRINGENT III P10 6=2533( REQUIREMENTS ARE INDICATED @ FACE CONT TRACK C INSTALL SHOP ORFIELD-FABRICATED,COLD FORMED FRAMING AND F40ENTPAI'ASF A10 r p SECURELY ANCHOR TO SUPPORTING STRUCTURE EACHFAGF$IT QG D INSTALL COLD FORMED STEEL FRAMING AND ACCESSORIES PLUMB,SQUARE AND.FROMFJpB f yiii^^^A AND TRUE TO LINE,AND WITH CONNECTIONS SECURELY FASTENED FASTEN HEADER E INSTALL FRAMING MEMBERS IN ONE-PIECE LENGTI{S UNLESS SPLICE IOCOLUMN CAP rBOXHEADEAVE' GYP SHEATHING - CONNECTIONSAREINDICATEOFORTRACKORTENSIONMEMBERS v,(4)�10 I2 EACH 1 (2)MOS16233 STUDS AND BOTH SIDESINSTALL ■ F TEMPORARY LOADS COMPARABLE AND TENSITRTSTD SECURE SEFOR WHICH AND SIDE OF COL.OWN I (2160J77L'J:TRACKS ` SUPPORT LOADS COMPARABLE IN INTENSITY TO THOSE FOR WHICH WEBI TUBE WAS DESIGNED MAINTAIN BRACES AND SUPPORTS PLACE Z UNDISTURBED w UNDISTURBED,UNTIL ENTIRE INTEGRATED SUPPOR7ING STRUCTURE HAS K G C BEEN COMPLETED AND PER FASTEN TRAC TO MANENT CONNECTIONS TO FRAMING ARE � x SECURED TOCOLUMN G DO NOT BRIDGE BUILDING EXPANSION JOINTS WTH COLD-FORMED STEEL USING(4)410 m 11051623311 FRAMING INDEPENDENTLY FRAME BOTH SIDES OF JOINTS 12 EACH SIDE) STUDS @ 16.D C H FASTEN HOLE ANUFATURER'REINFORCING PLATE PROVEDOVER WES PENETRATIONS STANDARD HAT OPENINGS / /\/\ SIZE OF MANUFACTURER'S APPROVED OR STANDARD PUNCHED OPENINGS sM+Psan RCHWBSw' 'IL/L/ 2 3 REPAIRS FASTENER PATTERN A PROVIDE FINAL PROTECTION AND MAINTAIN CONDITIONS,IN MANNER 6001121,"[33KSI)CA- $,F 3@STUD ACCEPTABLE TO MANUFACTURER AND INSTALLER.THAT ENSURE THAT COLD. ON TOP OF COLUMN \ ARLINGTON WA FORMED STEEL FRAMING IS WITHOUT DAMAGE OR DETERIORATION AT TIME LENGTH=6'CENTERED \ 600TI25d MUll OF SUBSTANTIAL COMPLETION W64CONT TRACK �2 SAFEWAY0 EXIST A' SIMPSON 1T EN HD - GOING BLAB 1r2k3@CLIP IS1 1' SLIDING DOOR HEADER TO POST OCONNECTION (DTYP,WALL SECTION 1 1/2"= -D" 314"=P-0" NOTICE �,%* TO PERMITEE AND/OR OWNER ❑ PARTIAL APPROVAL '7 CORRECTIONS REQUIRED Cl DO NOT OCCUPY 71 APPROVED PERMIT#: ! 7 LOT#: DATE: JOB ADDRESS: 2-OS ;gyp (�IYI"tPIL, TYPE OF INSPECTION: bl �A, A I ❑ NO PERMIT-STOP WORK-OBTAIN PERMIT:AND MAKE WORK COMPLY WITH CURRENT BUILDING AND/OR PLANNING CODES. ❑ CONSTRUCTION IS NOT IN ACCORDANCE WITH APPROVED PLANS AND PERMIT -STOP WORK:MAKE EXISTING WORK COMPLY WITH APPROVED PLAN AND PERMIT OR REMOVE IT. ❑ STOP WORK UNTIL AUTHORIZED TO CONTINUE BY INSPECTOR. ❑ CORRECTIONS LISTED BELOW MUST BE MADE BEFORE WORK CAN BE APPROVED. ❑ WORK NOT READY FOR INSPECTION: $50 REINSPECTION FEE (PER 1BC� MUST BE PAID PRIOR TO NEXT INSPECTION. j ❑ CONTACT INSPECTOR 360-403-3551 ❑ CALL FOR REINSPECTION al THE ACTIONS OR CORRECTIONS INDICATED ABOVE ARE REQUIRED WITHIN DAYS OR PENALTIES IMPOSED BYLAW MAYAPPLY. FOR INSPECTION CALL: 360-403-3417 l INSPECTOR DA MlffUILDING DEPT. 0 PLANNING DEPT. CITY OF ARLINGTON • CITY OF ARLINGTON 238 N. OLYMPIC AVE - ARLINGTON, WA. 98223 PHONE; (360) 403-3551 BUILDING PERMIT Address:20500 Olympic Place Permit#:2081 Parcel#:00847300000800 Valuation:40000.00 OWNER APPLICANT CONTRACTOR Name:SAFEWAY INC CPTS Name:Cuhaci&Peterson Name:Summit Properties Address:STORE# 1522 1850 MT DIABLO Address:1925 Prospect Avenue Address:6445 Citation Dr,Suite G BLVD#250 City,State Zip:WALNUT CREEK,CA 94596 City,State Zip:Orlando,FL 32814 City,State Zip:Clarkston,MI 48346 Phone: Phone:407-738-2998 Phone:248-625-4711 MECHANICAL CONTRACTOR PLUMBING CONTRACTOR Name: Name: Address: Address: City,State,Zip: City,State,Zip: Phone: Phone: LIC#: EXP: LIC#: EXP: JOB DESCRIPTION PERMIT TYPE: Commercial Alteration CODE YEAR: 2015 STORIES: I CONST.TYPE: DWELLING UNITS: 0 OCC GROUP: BUILDINGS: I OCC LOAD: PERMIT APPROVAL I AGREE TO COMPLY WITH CITY AND STATE LAWS REGULATING CONSTRUCTION AND IN DOING THE WORK AUTHORIZED THEREBY; NO PERSON WILL BE EMPLOYED IN VIOLATION OF THE LABOR CODE OF THE STATE OF WASHINGTON RELATING TO WORKMEN'S COMPENSATION INSURANCE AND RCW 18.27. THIS APPLICATION IS NOT A PERMIT UNTIL SIGNED BY THE BUILDING OFFICIAL OR HIS/HER DEPUTY AND ALL FEES ARE PAID. IT IS UNLAWFUL TO USE OR OCCUPY A BUILDING OR STRUCTURE UNTIL A FINAL INSPE ON HAS BEEN MADE AND APPROVAL OR A CERTIFICATE OF OCCUPANCY HAS BEEN GRANTED. IBC 110/IRC 110. SALES TAX NOTICE:Sales tax relating to construction and construction materials in the City of r n us ported on your sales tax return form and c ed ty o rf ton#3101. VO' Signa a Print Name VDate By Date CONDITIONS Adhere to approved plans. THIS PERMIT AUTHORIZS ONLY THE WORK NOTED.THIS PERMIT COVERS WORK TO BE DONE ON PRIVATE PROPERTY ONLY. ANY CONSTRUCTION ON THE PUBLIC DOMAIN(CURBS,SIDEWALKS,DRIVEWAYS,MARQUEES,ETC.)WILL REQUIRE SEPARATE PERMISSION. PERMIT FEES Date Description Fee Amount 8/24/2018 Building Permit Fee $783.43 8/24/2018 Building Plan Review Fee $509.23 8/24/2018 Processing/Technology Fee $25.00 8/24/2018 State Surcharge-Commercial $25.00 Total Due: $1,342.66 Total Payment: $0.00 Balance Due: $1,342.66 CALL FOR INSPECTIONS BUILDING(360)403-3417 When calling for an inspection please leave the following information: Permit Number,Type of Inspection being requested,and whether you prefer morning or afternoon Permit#: 2081 Permit Date: 08/06/18 Permit Type: COMMERCIAL ALTERATION Project Name: Safeway#1522 Applicant Name: Cuhaci & Peterson Applicant Address: 1925 Prospect Avenue Applicant, City, State, Zip: Orlando, FL 32814 Contact: Ernestina Lobo Phone: 407-738-2998 Email: Ernestinal@c-p.com Scope of Work: Grocery Staging Area Valuation: 40000.00 Square Feet: 0 Number of Stories: 0 Construction Type: Occupancy Group: ID Code: Permit Issued: 09/12/2018 Permit Expires: Form Permit Type: Status: COMPLETE Assigned To: Launa Black Property Parcel# Address Legal Description Owner Name Owner Phone Zoning 00847300000800 20500 OLYMPIC PL SAFEWAY INC 541 Groceries(With CPTS or Without Meat) Contractors Contractor Primary Contact Phone Address Contractor Type License License# Summit Properties Carl Matisse 248-625-4711 6445 Citation Dr, CONSTRUCTION Labor Suite G CONTRACTOR Industri and es SUMMIPD834KP Inspections Date Inspection Type Description Scheduled Date Completed Date Inspector Status 09/28/2018 C20.BUILDING Approved FINAL Plan Reviews Date Review Type Description Assigned To Review Status 08/06/2018 COMMERCIAL BUILDING ALTERATION Fees Fee Description Notes Amount Building Permit Table 4-1 $783.43 Building Plan Review Table 4-2 $509.23 Processing/Technology $25.00 State Surcharge-Commercial Commercial Only $25.00 Total $1,342.66 Attached Letters Date Letter Description 08/20/2018 Building Permit Payments Date Paid By Description Payment Type Accepted By Amount 09/12/2018 Andrew Bunting 71700322 cc $1,342.66 Outstanding Balance $0.00 Uploaded Files Date File Name 09/12/2018 3928956-2081 Issued Permit.pdf 08/06/2018 3789498-Safeway Olympic Place Commercial Application Packet 1JJMMbdj7ri8yE.pdf 08/06/2018 3789499-Safeway 534 Full Plan Set.pdf 08/06/2018 3789500-Safeway 1522 Full Plan Set.pdf 08/06/2018 3789501-Safeway Commercial Application Packet 1JJColtsMyA3Ln.pdf 08/06/2018 3789502-Safeway Cut Sheets.pdf 8 a 9 N orn v�i 0.1 P-i W # 522 SAFEWAY U) W Z Q a ° 2zco 1 0 V) 0 °g Z U U 20500 OLYMPIC PLACE WofmZ Boa ARL I N GTO N WA 98223 Qua f N N Lo ARCHITECT STRUCTURAL PROJECT SCOPE T_ PROJECT CONSISTS OF CREATING A GROCERY STAGING i ULU ENGINEER AREA FOR THE SHORT TERM HOLDING OF ONLIU N NE } CUHACI&PETERSON CUHACI&PETERSON GROCERY ORDERS PRIOR TO PICK UP BY CUSTOMER. ¢ Q a Lu W THE RENOVATED AREA HOUSES REACH-IN 550 TOWNSHIP LINE RD,STE 600 1925 PROSPECT AVENUE REFRIGERATORS,REACH-IN FREEZERS,SHELVING,AND A = w } w!O c= BLUE BELL,PA 19422 ORLANDO,FL 32814 WORK TABLE FOR ORDER TRACKING. NO CHANGE WILL w O 8 � Of PH:(215)641-4830 EXT 5215 PH:(407)661-9100 EXT 2451 BE MADE TO THE EXISTING CEILING,LIGHTING,HVAC,OR Q o J F SPRINKLERS IN THIS AREA WHICH WILL REMAIN AND w o� 8 Lu CONTACT:BARBARA HOGAN CONTACT:BRETT RYLANDS SERVE THE STAGING AREA.NO HOT FOOD WILL STORED IN THE STAGING AREA.ALL FOOD IS PACKAGED. I[[ k v NO FOOD PREPARATION WILL OCCUR IN THIS SPACE. Wo ARCHITECTURAL STRUCTURAL AO COVER SHEET S1 ENCLOSURE FRAMING ® Al EQUIPMENT PLAN,NOTES, CODES o DETAILS,AND SCHEDULES BUILDING: 20151BCOD ta o ; ELECTRICAL: 2017NEC PLUMBING: 2015 UPC Q, r IBC INFORMATION s USE GROUP: M MERCANTILE � CONSTRUCTION TYPE: IIIB GROSS BUILDING AREA: 43,096 SOFT. PROJECT AREA 238 SO.FT. o LL El E r W ® � 0 0 Lm pq��ggJy� W ZZZZ W _® H ". 'M a N ❑ o ❑ U m _ ------------�------------------------------------------------------------ 1522 ARLINGTON,WA - o SAFEWAYO - O NEW GROCERY AREA OF WORK AO STAGING AREA LEGEND GENERAL NOTES `--------- _ -----_----- _--_----- -----, EXISTING WALL 1. INSTALL ALL WORK IN ACCORDANCE WITH ALL CODES AND AS PER MANUFACTURER'S WRITTEN INSTRUCTIONS,MAINTAIN G MANUFACTURERS SPECIFIED CLEARANCES FOR ALL EQUIPMENT. p -f� NEW PARTIAL HEIGHTWALL WITH I/2'GWB,BOM SIDES. M 5EESHEETSI. 2. CONTRACTOR IS RESPONSIBLE FOR VERIFYING ALL DIMENSIONS SHOWN ON DRAWINGS AND TO REPORT ANY DISCREPANCIES TO A3 -- " " --___' ® NEW RAILING SEE DETAIL 3'A1 RELOCATE EQUIPMENT rTr-r-r--rrr-, r-r-_______- . AR HITE TAN Y I � ® EQUIPMENT NUMBER.SEE EQUIPMENT SCHEDULE. DEMOLITION NOTES 04 N C ON A) en\O 1. VERIFY EXTENT OF DEMOLITION w/SAFEWAY REPRESENTATIVE BEFORE COMMENCING. .. p" W ..,.; REMOVE EQUIPMENT _ --_ _ REMOVE EQUIPMENT I CL r-,-r rTr r-rr-�--r i 2. PATCH,REPAIR,AND CLEAN FLOORS AND WALLS TO MATCH EXISTING. ' i ' ' i i ii i i i � p. ......1 1 LJyL-- --- PL_LLL;y_LiLLLLLLL;y_LLLLLL�__ A� I I 3. VERIFY DISPOSITION OF REMOVED EQUIPMENT wISAFEWAY REPRESENTATIVE -__- C l GENERAL ELECTRICAL NOTES F N N r I I REMOVE BUMPER I. ALL WIRING SHALL BE RUN IN METALLIC CONDUIT.CONCEAL IN WALLS&CEILINGS IN FINISHED AREAS.MC CABLE MAY BE RUN y0j .. w ' i i i I � CONCEALED ABOVE CEILINGS OR IN WALLS WHERE NOT SUBJECT TO PHYSICAL DAMAGE. ---------------- 2. ALL EQUIPMENT SHALL BE INSTALLED INA NEAT AND WORKMANLIKE MANNER,PARALLEL&PERPENDICULARTO BUILDING STRUCTURE. 7 TYPE,UNLESS r r------------i 3. MINI MUMCONDUIT SIZES IRINGOBEC UNLESS NOTED ALL IRE SIZE SHOWN ON WIRE SIZE SHALLUIMENT14 THHN(REINEN r ____________________ THE MINIMUM ACCEPTABLE OTHERWISE. EI WINE SIZE.COP i PER.ALL WIRE SIZE SHOWN ON THE ELECTRICAL EQUIPMENT NOTESAAE INTENDED TO BE a -- 4. ALL WORK SHALL BE DONE IN ACCORDANCE WITH THE NEC(NFPA 70)2017,THE LATEST STATE CODES,AND LOCAL CODES. i L `""""--- -- ii I S. ALL ELECTRICAL EQUIPMENT,INCLUDING,BUT NOT LIMITED TO CONDUIT,WIRE.BOXES,AND FRTINGS,SHALL BE NEW AND FEE OF `---------'`---------i ----- - -i DEFECTS,SHALL BEAR THE UL LABEL,AND SHALL MEET NEVA AND ANSI STANDARDS. RELOCATE B. ALL WORK AND MATERIALS SHALL BE GUARANTEED FEE FROM DEFECTS FOR A MINIMUM PERIOD OF ONE YEAR UNLESS NOTED Q� EQUIPMENT REMOVE EQUIPMENT OTHERWISE. .fir DEMOLITION PLAN 7. THE COLORS OF ALL RECEPTACLES AND DEVICE PLATES SHALL MATCH EXISTING. V Al SCALE:1/4"=1'-0 21'-10 S CONTRACTOR TO VERIFY THAT NO PIPING,DUCTWORK EQUIPMENT ANY OTHER MECHANICAUPLUMBING EQUIPM IS RUN DIRECTLYABOVE ALIGN NEW WALL -------- - - ELECTRICAL PANELS. WI EXISTING SOFFIT yA)1 9. WHERE EXISTING EQUIPMENT IS SHOWN TO BE RELOCATED,ELECTRICAL CONTRACTOR SHALL PROVIDEALL CONDUR,JUNCTION BOXES, CABLE,&ACCESSORIES AS REWIRED TO REVISE EXISTING CIRCUITING TO ACCOMMODATE 14EW LOCATION OF EQUIPMENT - - 1 TO BE REUSED Sl - 19. ELEC MOOIFIEDRRETAAIL AREA LAOUT.TOR TO VERIFY IN THE FIELD ALL ANY FLOOR ECEPTACEAORJUNCTION BOX 1&JUNCTION 1440OT IN USE SHOULD BEER REMOVED AN RELOCATED ACCORDINGLY _--- � � � 0 SHOULD BE PATCHED FLUSH WITH MATERIAL TO MATCH EXISTING. 11. VERIFY ALL WORK TO BE DONE WITH SAFEWAY REPRESENTATIVE BEFORE PROCEEDING. I\ I I A \ RELOCATED N }{ 12. ELECTRICAL CONTRACTOR IS TO PROVIDE GFI PROTECTION FOR EQUIPMENT RECEPTACLES PER THE CURRENT ELECTRIC CODE. ,^e EOUIPMENT,SEE ELECTRICAL NOTE 1. F NEW J L J J L J J 13. ELECTRICAL CONTRACTOR SHALL FIELD VERIFY THE EXISTING ELECTRICAL PANELS TO DETERMINE THE PROPER LOCATION FOR THE `, WORK TABLE BY NEW CIRCUITS.VERIFICATION SHALL INCLUDE MONITORING OF THE ELECTRICAL LOAD WITHIN THE PANEL,UNDER FULL LOAD.TO Z Q OTHERS.SEE ELECTRICALO NOTE:EXISTING CEILING,LIGHT CONFIRM SPARE CAPACITY AS WELL AS THE PHYSICAL SPACE TO ADD BREAKERS.RELOCATE EXISTING BREAKERS AS NECESSARY OR Q 0 �j EQUIPMENTNOTE7. qgy FIXTURES,SPRINKLERS,AND EQUIRED TO FIND THE CORRECT SPACE.PROVIDE MONITORING RESULTS TO THE SAFEWAY PROJECT MANAGER,AND TO THE d DOOR POST,EACH HVAC TO EMAIN AND SERVE THE ARCHITECTIENGp1EER SIDE.SEE DTL 1/S1 EC SHALL'NO RECGHTONNECT FL GROCERY STAGING AREA. 1 O ZO N U) FXITURES ON ELECTRICAL EQUIPMENT NOTES c> > m w I I I I FIXTURES TO NEW Z Q J1,11 I I I I LIGHTING CONTROL 6 6 5 1. WHEE EXISTING EQUIPMENT IS SHOWN TO BE RELOCATED,ELECTRICAL CONTRACTOR SHALL PROVIDE ALL CONDUIT,JUNCTION 2 U 0p___ ___ :7)T - - - - - - BOXES,POWER POLES,CABLE AND ACCESSORIES AS REQUIRED TO REVISE EXISTING CIRCUITING AND ACCOMMODATE NEW s555 Z - W FL ----_-- LOCATION OF EQUIPMENT. � z 0 _ 2. ELECTRICAL CONTRACTOR SHALL PROVIDE FOR NEW AUTO SLIDING DOOR A HARDWIRED CONNECTION WITH 2p72,1p72G,314'C.TO W DoH (, - EXISTING PANEL.CONNECT TO AN EXISTING SPARE 20A,1 POLE BREAKER FOR CIRCUIT PROTECTION.PROVIDE TYPED,UPDATED e ~ � Z (n - ----- -- IIrrII IIrrII IIrrII IIrrII IIrrII IIrrII IIrrI IIrrIIIIrrIIIIrrIIIIrrII IIrrIIIIrr PANEL SCHEDULE FOR ENTIRE PANEL AFTER INSTALLATION. , L Q F- 1.1 (n 3. ELECTRICAL CONTRACTOR SHALL PROVIDE FOR NEW 24DOOR REACH-IN REFRIGERATOR ADUPLEX RECEPTACLE WITH(1)2p12,1p12G, Z m Lo Z --- - � 3/4'C.TO EXISTING PANEL CONNECT TO AN EXISTING SPARE(1)20A,1 POLE BREAKER FOR CIRCUIT PROTECTION.PROVIDE TYPED, � W J �J Q UPDATED PANEL SCHEDULE FOR PROVIPANELAFTER INSTALLATION. U Q .�Q_ Ln 4. ELECTRICAL CONTRACTOR SHALL ECT TO FOR NEW 3-DOOR(1)20AIN REFRIGERATOR A DUPLEX RECEPTACLE WITH(0)IDLE TYPED: J 3r4'C.TO EXISTING PANEL CONNECT TO AN EXISTING SPARE(1)20A.1 POLE BREAKER FOR CIRCUIT PROTECTION.PROVIDE MED, RELOCATED m, UPDATEDPANEL SCHEDULE FOR ENTIRE PANELAFTER INSTALLATION. QQ EQUIPMENT,SEE 5. ELECTRICAL CONTRACTOR SHALL PROVIDE FOR NEW i-DOOR RECH4N FREEZER A DUPLEX RECEPTACLE WITH(1)2#12,1p120,314-C. y LJ ELECTRICAL NOTE I. 1• -_"-' UPDATED PANEL SCHEDEL ULE FOR ENTIRE PANECT TO AN T ELAFTER INSTALLATION,POE BREAKER FOR CIRCUIT PROTECTION.PROVIDE TYPED,No y} Q CV 8. ELECTRICAL CONTRACTOR SHALL PROVIDE FOR NEW 2-DOOR REACH4N FREEZER A DUPLEX RECEPTACLE WITH(1)21112,1p12G,314-C. EQUIPMENT PLAN TO EXISTING PANEL.CONNECT TO AN EXISTING SPARE(1)20A,1 POLE BREAKER FOR CIRCUIT PROTECTION.PROVIDE TYPED, i Lo L] UPDATEDPANEL SCHEDULE FOR ENTIRE PANEL AFTER INSTALLATION. E Q a� SCALE:1l4"=1'-0" It- 7. ELECTRICAL CONTRACTOR SHALL PROVIDE FOR NEW GENERAL PURPOSE RECEPTACLE A DUPLEX RECEPTACLE WITH(1)2#12,1#12G, ug 0 314'C.TO EXISTING PANEL.CONNECT TO AN EXISTING SPARE(1)20A,1 POLE BREAKER FOR CIRCUIT PROTECTION.PROVIDE TYPED, .W m Z UPDATED PANEL SCHEDULE ELECTRICALEQUIPMENTSCHEDULE a J /J EXISTING CEILING Z g Q EXISTING OWE WALL BOX HEADER.SEE DTL 4151 `OPEN TO EXISTING EXTERIOR BREAKER Q(„)a ABOVE WALL DESCRIPTION AMPS VOLTS PHASE CYCLE PLUG RECEPT LOCATION F d NEWAUTOMATIC RAIL ; N _w f Z ~ SLIDING DOOR WI III W w J O W TEMPERED GLASS AUTO SLIDER DOOR 5 120 1 80 HZ HARDWIRE NONE WALL 20A11P uuu�+111 \ 518'DIA.,S" u U LL LL0Z Fd ANGLE 2-DOOR REACH-IN EFRIG. 7.4 1T0 1 80 HZ &20P 5.20R WALL 20AI1P . O C outside WEDGE BOLT 3-DOOR REACH-IN EFRIG. B.4 120 1 80 HZ &20P &20R WALL 20A11P In J tj N ® 1 117 DIA 1-DOOR REACH-IN FREEZER 9.7 120 1 80 HZ 5.20P 5.20R WALL 20A/lP a y W --- 2-DOOR REACH-IN FREEZER 112 120 1 BO HZ 5.20P 5.2DR WALL 2DAlIP GENERAL PURPOSE RECEPT. 1.5 120 1 BO HZ 5-20P 5-20R WALL 20AIlP 3"END POST ANGLE EQUIPMENT SCHEDULE \ NEW GWB EON STATUS DESCRIPTION MANUF. MODEL NOTES WALL,PTO HANDRAIL \-. OATS/ pD o Op 2 DOOR REACH-IN SELF-CONTAINED ON CASTERS.VERIFY LOCATION 1 NEW TRAULSEN G2D010 3: 0 REFRIGERATOR W/SAFEWAY REP.SEE ELEC EQUIP NOTE 3 0 NEW REFRIGERATORIN TRAULSEN 030010 WAYREP.SE NED ON CASTERS. EQUIPRIFY NOTETION WALL 4"x114"ANGLE NEW 1DOOR REACH-IN TRAULSEN 313010.023 SELF•CONTAINED ON CASTERS.VERIFY LOCATION m END FREEZER WI SAFEWAY REP.SEE ELEC EQUIP NOTE 5 BOLT DOWN�24'O.C. 04 NEW TRAULSEN G23010-023 {{ w 2 DOOR REACH•IN SELF-CONTAINED ON CASTERS.VERIFY LOCATION C, Q FREEZER WI SAFEWAY REP.SEE ELEC EQUIP NOTE 8 8 ❑ 5 NEW SHELVING COZIER INS VERIFY QUANTITY&LOCATION WI SAFEWAY REP.HT. D 0 5'-8'.SEE DETAILS 41A1,51A1&61A1. --- $ RAILING DETAILS rAUTOMATIC FULL BREAKOUT SINGLE SLIDING DOOR PROVIDED BY � Z © NEW SLIDING DOOR ASSA ABLOY SL500 SAFEWAY.INSTALL PER MANUFACTURER'S Al SCALE:314"=1'-0" INSTRUCTIONS.SEE 51S1 FOR CONNECTION DTL.SEE i NEW COVE BASE ELEC EQUIP NOTE 2 MJ �2 1 NEW WALL ELEVATION FINISH SCHEDULE FOR GROCERY STAGING AREA 3 g # LOCATION I STATUS DESCRIPTION JU SCALE:1Yt"=1'4Y CT CEILING EXISTING REMAINTO EXISTING ACOUSTICAL CEILING TILE �- NON BACK-TO-BACK W01 WALL&COVE EXISTING TO CONDITION, BASE REMAIN WASHABLE PAINT.VINYL COVE BASE. - I TYP. � � � ANCHOR,TYP. WALL 8 COVE UPRIGHT,PP. GONDOLA ® � � ® BASE NEW WASHABLE PAINT TO MATCH EXISTING.VINYL COVE BASE TO MATCH EXISTING � i m ~ W GONDOLA ® ® FL FLOOR EXISTING TO COMMERICAL GRADE VINYL TILE Jul �M C w r REMAIN SUPPORT ® G c O A x U 2 UPRIGHTS=FOUR ANCHOR PLATES 4 UPRIGHTS=SIX ANCHOR PLATES yl � - 1522 ARLINGTON,WA 5 UPRIGHTS=SIX ANCHOR PLATES 0 STAB L 2affiSEISMIC.SIMPS N TITE BY MADIX WI TT-� ® SAF E WAY" ANCHOR SIM3112"E TENHDSCREW ® HUM: ® • . ANCHORS PER IC'EMBEDMENT, �W INSTALLED PER ICC REPORT ESR-2713 � -- ...._.__...___.�.._..........._._...._..........-. 7 UPRIGHTS=EIGHT ANCHOR PLATES W/SPECIAL INSPECTION.SEE DETAIL \ - v A 1 31A1 FOR LAYOUT �I U a n r41 GONDOLA ANCHORAGE DETAILS s GONDOLA ANCHORAGE TO SLAB DETAIL �s1 SHELVING ELEVATION e R Am F I ORK Al SCALE:3/4"=T4T N.T.S. al N.T.B. KEY PLAN GENERAL: A. THESE GENERAL NOTES ARE NOT INTENDED TO REPLACE SPECIFICATIONS.SEE TYPICAL DETAIL NOTES SPECIFICATIONS FOR REQUIREMENTS IN ADDITION TO GENERAL NOTES. r.5 B. NOT ALL EXISTING CONDITIONS,PROPOSED CONDITIONS,OR UTILITIES ARE SHOWN ON THE DRAWINGS.COORDINATE STRUCTURAL WORK WITH THE WORK OF OTHER TRADES.IN CASE OF CONFLICT,NOTIFY THE DESIGN PROFESSIONAL. 1. ALL STUDS SHALL BE 33-MIL(20 GAUGE)-33KSI UNLESSC. ONLY USE DIMENSIONS INDICATED ON THE DRAWINGS.DO NOT SCALE NOTED OTHERWISE.D. EEAITIONSINDICATEDONTHESTRUCTURALDRAWINGSAREBASEDONA 2. USEG40GALVANIZINGMINIMUMFORALLSTUDS.PROJECT DATUM INDICATED ON THE ARCHITECTURAL DRAWINGS. 3. ALL SCREWS ARE#10 SELF-TAPPING PANCAKE-HEAD,UNLESS a � 00 t-- NOTED OTHERWISE IN THE DETAILS. w DESIGN CRITERIA: A. 2015INTERNATIONAL BUILDING CODE B. ASCE 7-10,MINIMUM DESIGN LOADS FOR BUILDINGS AND OTHER STRUCTURES C. SERVICEABILITY AND DEFLECTION CRITERIA PER GOVERNING COMPONENT DESIGN STANDARD D. AISI S100-16,NORTH AMERICAN SPECIFICATION FOR THE DESIGN OF COLD- FORMED STEEL STRUCTURAL MEMBERS AND AISI S220-15 DESIGN LOADING: A. DEAD LOAD: SELF-WEIGHT B. LIVE LOADS-PARTITION: 5 PSF HORIZONTAL[GOVERNS] C. WIND LOADING: N/A D. FLOOD DESIGN DATA: N/A E. DESIGN L LOADING (DES VALUES OF SOIL: N/A F. SEISMIC LOADING(DESIGN CATEGORY AND CLASS) 1. RISK CATEGORY:II 2. SITE CLASS:D 3. SEISMIC IMPORTANCE FACTOR(IftCC TI1.0W 4. DESIGN SPECTRAL RESPONSE ACCELERATION PARAMETERS: e. S.: 2.09(WORST CASE DESIGN USED j FOR SYSTEM) SUBMITTALS: RCKW5.5 KNEEWALL (6)#12SCREWS 81/4' •� CONNECTOR 314" 3' 3• 1112" § A. THE FOLLOWING SUBMITTALS ARE REQUIRED:COLD-FORMED STUD,CLIPS, SCREWS, AND ANCHORAGE. Cn OC O O 'sue rih (iI W6x8 5 ff Z Q POST-INSTALLED ANCHOR REQUIREMENTS: O O O O O `I' `)' a w I A. USE SIMPSON TITEN HD HEAVY-DUTY SCREW ANCHORS-ZINC PLATED. �., I 0 O} rn B. INSTALLATION SHALL CONFORM TO THE MANUFACTURER'S PUBLISHED O C O p O INSTALLATION INSTRUCTIONS,WHERE HOLES ARE DRILLED IN CONCRETE, *,g Z Q HOLES SHALL BE ACCURATELY AND SQUARELY DRILLED,AND THE HOLES - _ I _ (I� _ 8 Z U U SHALL BE CLEANED IN ACCORDANCE WITH THE MANUFACTURER'S `Y j RECOMMENDATIONS. _ - I Z zi O C. UNLESS OTHERWISE NOTED,ANCHORS SHALL BE INSTALLED IN HOLES DRILLED INTO BASE MATERIALS USING CARBIDE-TIPPED DRILL BITS 3/16 Z CONFORMING TO ANSI 8212.15-1994, Q D. WHERE MANUFACTURER RECOMMENDS USE OF SPECIAL TOOLS FOR I i- LLJ N Q NOTES: LLl INSTALLATION OF ANCHORS,SUCH TOOLS SHALL BE USED,UNLESS 1. FRAMING AND ANCHORAGE NOT SHOWN FOR CLARITY. 314"PL 8.25"z5' 911610 w m N J OTHER WISE PERMITTED SPECIFICALLY BY THE ENGINEER OR ARCHITECT 2. SCREW PATTERN 3 IS AS SHOWN IN DETAIL.DO NOT DEVIATE. TYP.EA. U Q u a OF RECORD. 3. CONNECTOR SHALL BE CENTERED ON WALL FRAMING, FLANGE E. IDENTIFY POSITION OF REINFORCING STEEL AND OTHER EMBEDDED ITEMS 3/16 PRIOR TO DRILLING HOLES FOR ANCHORS.EXERCISE CARE IN DRILLING TO g AVOID DAMAGING EXISTING REINFORCING OR EMBEDDED ITEMS.NOTIFY ``1n1 THE ENGINEER IF REINFORCING STEEL OR OTHER EMBEDDED ITEMS ARE V ENCOUNTERED DURING DRILLING. N Z F. SPECIAL INSPECTION:FOR MECHANICAL ANCHORS QUALIFIED FOR USE IN SIMPSON RCKW5.5 FASTENING BASE PLATE c CRACKED AND UNCRACKED CONCRETE IN ACCORDANCE WITH ICC-ES © 6'=1'-O" O 3"=1'-O" N C AC193,PERIODIC SPECIAL INSPECTION IS REQUIRED. Lo " W a *k w N LL- SECTION 054000•COLD-FORMED METAL FRAMING j Z 0 rn LLJ PART1-PRODUCTS 0_ Q 1.1 COLD-FORMED STEEL FRAMING,GENERAL: Q U A. ASTM A 1003/A 1003M,STRUCTURAL GRADE,TYPE H,METALLIC COATED,OF W6x8.5 98-1/4' >a (n GRADE AND COATING WEIGHT G40(MIN.). 1l4' W THICK WOOD TOOF COL = >2 Z B. STEEL STUDS:MANUFACTURER'S STANDARD"HAPED STEEL STUDS,OF WEB SHIM W6x8.5 U) J O O DEPTHS INDICATED,PUNCHED,WITH STIFFENED FLANGES,AND AS FOLLOWS: U 1. MINIMUM BASE-METAL THICKNESS:0.0329 INCH. A992 G U o Z V 2. MINIMUM FLANGE WIDTH:1-SIB INCHES. ALUMINUM DOOR w O Q�J F Z C. STEEL TRACK:MANUFACTURER'S STANDARD U-SHAPED STEEL TRACK,OF WEB 60OT125-33 TRACKS @SIDE JAMB 5 O Q w w DEPTHS INDICATED,UNPUNCHED,WITH STRAIGHT FLANGES,AND AST OF POST.FASTEN wI(2) S.1 ; N ti FOLLOWS: ROWS OF FASTENERS @ #14 SELF-DRILLING 1. MINIMUM BASE-METAL THICKNESS:MATCHING STEEL STUDS. 1T O.C.STAGGERED FLAT HEAD SCREW Q 2. MINIMUM FLANGE WIDTH:1-1/4 INCHES. WITH WINGS-TYPE I 1.2 FABRICATION 410 STAINLESS A. FABRICATE COLD-FORMED STEEL FRAMING AND ACCESSORIES PLUMB, GYPSUM BOARD LENGTH 3-1/4' (DOOR) SQUARE,AND TRUE TO LINE,AND WITH CONNECTIONS SECURELY FASTENED, O'CON ws ACCORDING TO REFERENCED AISI'S SPECIFICATIONS AND STANDARDS,AND ■ b MANUFACTURER'S WRITTEN INSTRUCTIONS. - EXIST.4' 3 B. FABRICATION TOLERANCES:FABRICATE ASSEMBLIES LEVEL,PLUMB,AND TRUE MIN.CONIC, TO LINE TO A MAXIMUM ALLOWABLE TOLERANCE VARIATION OF 1181NCH IN 10 SLAB BASE PLATE i FEET AND AS FOLLOWS: NOTE: INSTALL(4)#14SCREWS AT HEADER Pi 1. SPACING:SPACE INDIVIDUAL FRAMING MEMBERS NO MORE THAN ROUGH OPENING y S 3 3 SPACED 1"FROM TOP AND 1.5'ON CENTER. 0" 3 PLUS OR MINUS 1/81NCH FROM PLAN LOCATION.CUMULATIVE ERROR PER DOOR MFR y SHALL NOT EXCEED MINIMUM FASTENING REQUIREMENTS OF FASTEN REMAINING SCREWS @ 24'O.C. TOP OF SLAB SHEATHING OR OTHER FINISHING MATERIALS. MAX.SPACING 2. SQUARENESS:FABRICATE EACH COLD-FORMED STEEL FRAMING ASSEMBLY TO MAXIMUM OUT-OF-SQUARE TOLERANCE OF 118INCH. SIMPSON TITEN HD PART 2-EXECUTION 11Tx4' o 2.1 EXAMINATION: A. EXAMINE SUPPORTING SUBSTRATES AND ABUTTING STRUCTURAL FRAMING FOR COMPLIANCE WITH REQUIREMENTS FOR INSTALLATION TOLERANCES AND O SLIDING DOOR TO POST CONNECTION O TYP.SLIDING DOOR POST g OTHER CONDITIONS AFFECTING PERFORMANCE OF THE WORK.PROCEED 3"=1'-0" 3/4"=1'-0" WITH INSTALLATION ONLY AFTER UNSATISFACTORY CONDITIONS HAVE BEEN i CORRECTED. 22 INSTALLATION,GENERAL: A. COLD-FORMED STEEL FRAMING MAY BE SHOP OR FIELD FABRICATED FOR i w INSTALLATION,OR IT MAY BE FIELD ASSEMBLED. B. INSTALL COLD-FORMED STEEL FRAMING ACCORDING TO AISI S200 AND TO (1)#10 600T125-33(33KSI) w O MANUFACTURER'S WRITTEN INSTRUCTIONS UNLESS MORE STRINGENT FACE CONT.TRACK u REQUIREMENTS ARE INDICATED. FASTEN TRACKS wI#10 j C. INSTALL SHOP-OR FIELD-FABRICATED,COLD-FORMED FRAMING AND EACH FACE @ IT O.C. SECURELY ANCHOR TO SUPPORTING STRUCTURE. AND 3"FROM ENDS D. INSTALL COLD-FORMED STEEL FRAMING AND ACCESSORIES PLUMB,SQUARE, FASTEN HEADER AND TRUE TO LINE,AND WITH CONNECTIONS SECURELY FASTENED. TO COLUMN CAP GYP.SHEATHING E. INSTALL FRAMING MEMBERS IN ONE-PIECE LENGTHS UNLESS SPLICE w/(4)#10[2 EACH BOX HEADER wl BOTH SIDES SIDE OF COLUMN (2)600TI25-33 STUDS AND CONNECTIONS ARE INDICATED FOR TRACK OR TENSION MEMBERS. (2)6DDS125-33 TRACKS F. INSTALL TEMPORARY BRACING AND SUPPORTS TO SECURE FRAMING AND SUPPORT LOADS COMPARABLE IN INTENSITY TO THOSE FOR WHICH WEB] O STRUCTURE WAS DESIGNED.MAINTAIN BRACES AND SUPPORTS IN PLACE, F c O UNDISTURBED,UNTIL ENTIRE INTEGRATED SUPPORTING STRUCTURE HAS BEEN COMPLETED AND PERMANENT CONNECTIONS TO FRAMING ARE FASTEN TRACK m $ SECURED. TO COLUMN G. DO NOT BRIDGE BUILDING EXPANSION JOINTS WITH COLD-FORMED STEEL USING(4)#W £D 600$162-33(33KSI) n' o V FRAMING.INDEPENDENTLY FRAME BOTH SIDES OF JOINTS. [2 EACH SIDE] SIMPSON STUDS N 16'RC Q.C. 1522 H. FASTEN HOLE REINFORCING PLATE OVER WEB PENETRATIONS THAT EXCEED SIMPSON RCKW5.5 w1 SIZE OF MANUFACTURER'S APPROVED OR STANDARD PUNCHED OPENINGS. 6 FASTENER PATTERN 2.3 REPAIRS: 6ODT125-33[33KSI]CAP 8.1 3 @ STUD A. PROVIDE FINAL PROTECTION AND MAINTAIN CONDITIONS,INA MANNER ON TOP OF COLUMN ARLINGTON,WA ACCEPTABLE TO MANUFACTURER AND INSTALLER,THAT ENSURE THAT COLD- LENGTH=6'CENTERED 600T125.33(33KSI) FORMED STEEL FRAMING IS WITHOUT DAMAGE OR DETERIORATION AT TIME CONT.TRACK OF SUBSTANTIAL COMPLETION. W6x8.5 AM SAFEWAY0 EXIST.4' SIMPSON TITEN HD CONIC.SLAB 1ITz3@CLIP SLIDING DOOR HEADER TO POST ®CONNECTION O TYP.WALL SECTION 1 1/2"=1'-0" 3/4"=1'-0" 0 M ate+ b N O Q1 o 'El .N..J.�.i WSAFEWAY # 0 5 3 4 �1 9 .� � U l w Z aZ 00 Z00 voY, ZUU 3532 172ND STREET NE 'w ? ° w 'w ,-z a ARL I N GTO N WA 98223U Qua A Lo ARCHITECT STRUCTURAL PROJECT SCOPE ENGINEER PROJECT CONSISTS OF CREATING A GROCERY STAGING AREA FOR THE SHORT TERM HOLDING OF ONLINE �_� GROCERY ORDERS PRIOR TO PICK UP BY CUSTOMER. 4 Q wW ® ULJ[JLJLJUULJLJ� ��U CUHACI&PETERSON CUHACI&PETERSON THE RENOVATED AREA HOUSES REACH-IN � 550 TOWNSHIP LINE RD,STE 600 1925 PROSPECT AVENUE REFRIGERATORS,REACH-IN FREEZERS,SHELVING,AND A a w > W z O BLUE BELL,PA 19422 ORLANDO,FL 32814 WORK TABLE FOR ORDER TRACKING,NO CHANGE WILL w F Lu BE MADE TO THE EXISTING CEILING,LIGHTING,HVAC,OR ° Z r L1J o ❑ ❑ PH:(215)641-4830 EXT 5215 PH:(407)661-9100 EXT 2451 SPRINKLERS IN THIS AREA WHICH WILL REMAIN AND W 0 Q x w 0 ❑ CONTACT:BARBARA HOGAN CONTACT:BRETT RYLANDS SERVE THE STAGING AREA.NO HOT FOOD WILL BE a C7 "Q w O o ❑❑ ® LJ STORED IN THE STAGING AREA.ALL FOOD IS PACKAGED. L�J NO FOOD PREPARATION WILL OCCUR IN THIS SPACE. ARCHITECTURAL STRUCTURAL I � ® ElO AO COVER SHEET S1 ENCLOSURE FRAMING CODES Al EQUIPMENT PLAN,NOTES, � � o DETAILS,AND SCHEDULES m BUILDING: 201518C a 3 ELECTRICAL: 201 NEC `^, I PLUMBING: 2015 UPC g o IBC INFORMATION m USE GROUP: "M"MERCANTILE CONSTRUCTION TYPE: 3B m GROSS BUILDING AREA: 55,891 SQ.FT. 0 PROJECTAREA 196SQ.FT. o ® ❑ O ® � ® Z o a � O � ❑ � V m 0 0 ❑ / 8 0534 pp pppp pppp 00 00 60 O O❑ p ®® ARLINGTON,WA REWOROCERY e 8 STAGING AREA —�—® SAFEWAY" AO AREA OF WORK LEGEND GENERAL NOTES EXISTING WALL o 1. INSTALLALL WORK IN ACCORDANCE WITH ALL CODES AND AS PER MANUFACTURERS WRITTEN INSTRUCTIONS.MAINTAIN 4______�__' ❑ NE WPARTIALHEIGHTWALLWITHI2'GWB,BO RKES. L4WUFACNRER'S SPECIFIED CLEARANCES FOR ALL EQUIPMENT. O - - - ------ ---- ---------t -- ------- - ----- --- ----- ----- --- ---- SEESHEET Si. 2. CONTRACTOR IS RESPONSIBLE FOR VERIFYING ALL DIMENSIONS SHOWN ON DRAWINGS AND TO REPORTANV DISCREPANCIES TO EQUIPMENT NUMBER.SEE EQUIPMENT SCHEDULE. ARCHITECT AND/OR SAFEWAY REPRESENTATIVE. a N REMOVE EXISTING RELOCATE EXISTING DEMOLITION NOTES y N C O\ REMOVE L , CABINETS AND EQUIPMENT CAB M CABINETS AND EQUIPMENT 1. VERIFY EXTENT OF DEMOLITION WSAFEWAY REPRESENTATIVE BEFORE COMMENCING. - OO EXISTING 2. PATCH,REPAIR,AND CLEAN FLOORS AND WALLS TO MATCH EXISTING. SHELVING r____ _____- _ 3. VERIFY DISPOSITION OF REMOVED EQUIPMENT REPRESENTATIVE. -___ ter-. V GENERAL ELECTRICAL NOTES H '� 3 - _ 1. ALL WIRING SHALL RERUN IN METALLIC CONDUIT.CONCEAL IN WALL58 CEILINGS M FINISHEDAAEJS.MC CABLE MAYBE RUN )® I i ' CONCEALED ABOVE CEILINGS ORIN WALLS WHERE NOT SUBJECTTO PHYSICAL DAMAGE. 2. ALL EQUIPMENT SHALL BE INSTALLED IN A NEAT AND WORKMANLIKE MANNER,PARALLEL B PERPENDICULAR TO BUILDING STRUCTURE. REMOVE EXISTING 3. MINIMUM CONDUIT SIZE SHALL BE 3/4',UNLESS NOTED OTHERWISE.MINIMUM WI RE SIZE SHALL BE#12 AWG THHNRWIN TYPE,UNLESS CABINETRY EQUIPMENT NOTED OTHERWISE.ALL WIRING TO BE COPPER.ALL WIRE SIZE SHOWN ON THE ELECTRICAL EQUIPMENT NOTESARE INTENDED TO BE THE MINIMUM ACCEPTABLE WALE SIZE. -------- 4. All WORK SHALL BE DONE IN ACCORDANCE WITH THE 14EC(NFPA 70)2D17,THE LATEST STATE CODES,AND LOCAL CODES. RELOCATE EXISTING DISPLAYS I III e I i 5. ALL ELECTRICAL EQUIPMENT,INCLUDING,BUT NOT LIMITED TO CONDUIT,WIRE,BOXES,AND FITTINGS,SHALL BE NEW AND FREE OF DEFECTS,SHALL BEAR THE UL LABEL,AND SHALL MEET NEMA AND ANSI STANDARDS. - B. ALL WORK AND MATERIALS SHALL BE GUARANTEED FREE FROM DEFECTS FOR A MINIMUM PERIOD OF ONE YEAR UNLESS NOTED OTHERWISE. D DEMOLITION PLAN 7. THE COLORS OF ALL RECEPTACLES AND DEVICE PLATES SHALL MATCH EXISTING. S. CONTRACTOR TO VERIFY THAT NO PIPING,DUCTWORK,OR ANY OTHER MECHANICAUPLUMBING EQUIPMENT IS RUN DIRECTLY ABOVE Al SCALE:114"=I-D" ELECTRICAL PANELS. 9. WHERE EXISTING EQUIPMENT IS SHOWN TO BE RELOCATED,ELECTRICAL CONTRACTOR SHALL PROVIDEALL CONDUIT,JUNCTION BOXES, __-----.._--_-_ ______ _ ____ __ _ CE�;;o ___ _-______________ 0 TRICAL CONTRACTOR TO VERIFY IN THE FIELD ALL RECEPTACLES ACCESSORIES T IN CIRCUITING 1. ELEC 8 JUNCTION BOXES TO BE REUSED OR RELOCATED ACCORDINGLY -- WITH MODIFIED RETAIL AREA LAYOUT.ANY FLOOR RECEPTACLE OR JUNCTION BOX NOT IN USE SHOULD BE REMOVED,AND FLOOR - __--.._-----------------------0-- ------_-A� _ SHOULD BE PATCHED FLUSH WITH MATERIAL TO MATCH EXISTING. % _____ 11. VERIFY ALL WORK TO BE DONE WITH SAFEWAY REPRESENTATIVE BEFORE PROCEEDING. (6)RELOCATED 2%V FH _ 12. ELECTRICAL CONTRACTOR IS TO PROVIDE GFI PROTECTION FOR EQUIPMENT RECEPTACLES PER THE CURRENT ELECTRIC CODE. Tn WIRE PANELS FOR .� RELOCATED CABINETS AND .� L1J MERCHANDISE DISPLAY DOOR POST,EACH 13. ELECTRICAL CONTRACTOR SHALL FIELD VERIFY THE EXISTING ELECTRICAL PANELS TO DETERMINE THE ROPER LOCATION FOR THE $� EQUIPMENT.SEE ELEC EQUIP NOTEI NEW CIRCUITS.VERIFICATION SHALL INCLUDE MONITORING OF THE ELECTRICAL LOAD WITHIN THE PANEL,UNDER FULL LOAD,T0 Z SIDE.SEE OTL 21S7 Q W02 5 RED IRMSPARE FIND O R CTSWEL ACE.P PHYSICAL SPACETO ADO BREAKERS.RELOCATE EXISTING MANAGER, ADTOTHE OR L Q REQUIRED TO FIND THE CORRECT SPACE.PROVIDE MONITORING RESULTS TO THE SAFEWAY PROJECT MANAGER,ANO TO THE d � ARCHITECT/ENGINEER Z NOTE:EXISTING CEILING,LIGHT r-D1rz' ELECTRICAL EQUIPMENT NOTES 0 rn Lu FUTURES,SPRINKLERS,AND 4 NEW WORK TABLE 4 Y- y-I �❑ Z Q R.O. 1 =MM HVAC TO REMAIN AND SERVE THE = -- ,,••, 1. WHERE EXISTING EQUIPMENT I5 SHOWN TO BE RELOCATED,ELECTRICAL CONTRACTOR SHALL PROVIDE ALL CONDUIT,JUNCTION U GROCERY STAGING AREA. �ECL RE-CONNECT - - -_ - BOXES,POWER POLES,CABLE AND ACCESSORIES AS REQUIRED TO REVISE EXISTING CIRCUITING AND ACCOMMODATE NEW Z - WOTHERS.SEE ELECTRICALLOCATION OF EQUIPMENT. 0 Z Z EQUIPMENT NOTE 6. EXISTING LIGHT _ _ I O = T- \ \ \ \ FU(TURfyS TO NEW a RELOCATED RUG 2 X MISTING PANEL CONNECT TO AN E. ELECTRICAL C TOR SHALL XISTDE ING 20A,1 NEW AUTO SLIDING POL BREAKER FOR C RCUIT PROTECTION.CONNECTION PROVIDE TYPED,UPDATED W ~ - Z U) \ i L 11TING CONTROLQ' Q DOCTOR EQUIP PANEL SCHEDULE FOR ENTIRE PANEL AFTER INSTALLATION. , Z w l7 Q 3. ELECTRICAL CONTRACTOR SHALL PROVIDE FOR NEW 3-DOOR REACH-IN REFRIGERATOR A DUPLEX RECEPTACLE WITH(1)2#12,1#12G, Z CT W02 3/4'C.TO EXISTING PANEL.CONNECT TO AN EXISTING SPARE(1)20A 1 POLE BREAKER FOR CIRCUIT PROTECTION.PROVIDE TYPED, j J J Q UPDATED PANEL SCHEDULE FOR ENTIRE PANEL AFTER INSTALLATION. V Q d CD O =C-L) 4. ELECTRICAL CONTRACTOR SHALL PROVIDE FOR NEW 1-DOOR REACIHN FREEZER A DUPLEX RECEPTACLE WITH(1)2#12,1#12G,34'C. FL TO EXIST MG PANEL CONNECT TO AN EXISTING SPARE(1)20A,7 POLE BREAKER FOR CIRCUIT PROTECTKN.PROVIDE TINED, E J UPDATED PANEL SCHEDULE FOR ENTIRE PANELAFTERINSTALIATION. < ---- _ -- 5. ELECTRICAL CONTRACTOR SHALL PROVIDE FOR NEW 2-DOOR REACH-IN FREEZER A DUPLEX RECEPTACLE WITH(1)2#12,1#120,34'C. /( TO EXISTING PANEL CONNECT TO AN EXISTING SPARE(1)20A,1 POLE BREAKER FOR CIRCUIT PROTECTION.PROVIDE TYPED, p Lu UPDATED PANEL SCHEDULE FOR ENTIRE PANELAFTER INSTALLATION. � �A 6. ELECTFUCAL CONTRACTOR SHALL PROVIDE FOR NEW GENERAL PURPOSE RECEPTACLE A DUPLEX RECEPTACLE WITH(1)2#12,11H2G, ♦,^' (15 EQUIPMENT PLAN 314'C.TO EXISTING PANEL.CONNECT TO AN EXISTING SPARE(1)Mk1 POLE BREAKER FOR CIRCUIT PROTECTION.PROVIDE TYPED, L ! W UPDATED PANEL SCHEDULE FOR ENTIRE PANEL AFTR INSTALLATION. B O O Al BDALE`'""_'" ELECTRICAL EQUIPMENT SCHEDULE BREAKER ccVV DESCRIPTION AMPS VOLTS PHASE CYCLE PLUG RECEPT LOCATION (0 N Z SIZE EXISTING CEILING z > W W Q L.PENTO AUTO SLIDER DOOR 5 120 1 60HZ HARDWIRE NONE WALL 20A/1P (O Q Z Q BOX HEADER.SEE DR 431 � Q Z F 3 ��-/] 3-000R REACH-IN REFRIG. 8.4 120 1 60 HZ 5-20P 5-20R WALL 2TAIT P y .3:0 Z Z NEWAUTOMATIC / . IM } O SLIDING DOOR WI 1-DOOR REACH-IN FREEZER 9.7 120 1 60 HZ 5-20P 5.20R WALL 20A11P LLI Z F W TEMPERED GLASS C W LL�(O 2-DOOR REACH-IN FREEZER 11.2 12D 1 60 HZ 5.20P 5-20R WALL 20A11 P U O cq J a GENERAL PURPOSE RECEPT. 1.5 120 1 60 HZ 5-20P 5-20R WALL 20A11P $ EQUIPMENT SCHEDULE EQ# STATUS DESCRIPTION MANUR MODEL NOTES _m 3 DOOR REACH-IN SELF-CONTAINED ON CASTERS.VERIFY LOCATION 1 NEW TRAUSEN G30010 I REFRIGERATOR WI SAFEWAY REP.SEE ELEC EQUIP NOTE 3 z L NEW GWB 2 NEW 1 DOOR REACH-IN TRAUSEN G13010-M SELF-CONTAINED ON CASTERS.VERIFY LOCATION �¢ FREEZER WI SAFEWAY REP.SEE ELEC EQUIP NOTE 4 z� WALL,PTD m o J O NEW 2 DOOR REACH-IN TRAUSEN G23010-M SELF-CONTAINED ON CASTERS.VERIFY LOCATION t ; FREEZER WI SAFEWAY REP.SEE ELEC EQUIP NOTE 5 o \ \ c NEW SHELVING LOZIER WS 5r.SEE DETAI S 31A10,4 Al TI d 51AI. REP.HT. j ?'AUTOMATIC FULL BREAKOUT SINGLE SLIDING DOOR PROVIDED BY t NEW SLIDING DOOR ASSA ABLOY SL500 SAFEWAY.INSTALL PER MANUFACTURER'S a m INSTRUCTEQUIPIONSNOTE2. 1181 FOR CONNECTION DTL.SEE Q FINISH SCHEDULE FOR GROCERY STAGING AREA e o NEW COVE BASE # LOCATION STATUS DESCRIPTION z 0 CEILING EXISTRE EXISTING ACOUSTICAL CEILING TILE yygW NEW WALL ELEVATION W01WALL 6COVE EXBASE ISTING TO WASHABLEPAINT.VINYLCOVEBASE. W p Ai SCALE:10=T-W ® BWA LL 6 COVE NEW WASHABLE PAINT TO MATCH IXISTING.VINYL COVE BASE TO MATCH EXISTING 7 L� R Ir EXISTINGTO - Q FLOOR REMAIN COMMERICAL GRADE VINYL TILE NO BACK-TO-BACK 9 CONDITION,TVP. d ANCHOR, UPRIGHT,TYP. GONDOLA ©® ® m -• � p 0 z m o U II�p� ® � W SUPPORT GONGOLA 2 UPRIGHTS=FOUR ANCHOR PLATES 4 UPRIGHTS=SIX ANCHOR PLATES m 8 oll� III 054 ARLINGT3W 5 UPRIGHTS=SIX ANCHOR PLATES o ® ®o� et So If p H BLAB SEISMIC ANCHOR PLATE BY MADU WI IOPG IUPB lUP7 r 2 SIS'DIA.SIMPSON TITEN HD SCREW SAFE WAY" ANCHORS W13112'EMBEDMENT, INSTALLED PER ICC REPORT ESR-2713 WI SPECIAL INSPECTION.SEE DETAIL is 7 UPRIGHTS EIGHT ANCHOR PLATES VA1 FOR LAYOUT A 1 s GONDOLA ANCHORAGE DETAILS a GONDOLA ANCHORAGE TO SLAB DETAIL SHELVING ELEVATION AREA OF WORK Al SCALE:34"=,'D` Al N.T.S. At N.T.B. KEY PLAN GENERAL: A. THESE GENERAL NOTES ARE NOT INTENDED TO REPLACE SPECIFICATIONS.SEE TYPICAL DETAIL NOTES s SPECIFICATIONS FOR REQUIREMENTS IN ADDITION TO GENERAL NOTES. �^ B. NOT ALL EXISTING CONDITIONS,PROPOSED CONDITIONS,OR UTILITIES ARE ,43 SHOWN ON THE DRAWINGS.COORDINATE STRUCTURAL WORK WITH THE WORK 1. ALL STUDS SHALL BE 33-MIL(20 GAUGE)-33KSI UNLESS OF OTHER TRADES.IN CASE OF CONFLICT,NOTIFY THE DESIGN PROFESSIONAL. 'd C. ONLY USE DIMENSIONS INDICATED ON THE DRAWINGS.DO NOT SCALE NOTED OTHERWISE. PG N D. EL�EAITIONSINDICATED ON THE STRUCTURALDRAWINGS ARE BASED ONA 2. USEG40GALVANIZINGMINIMUMFORALLSTUDS. PRaATI DATUM INDICATED ON THE STRUCTURAL RAV41 DRAWINGS. 3. ALL SCREWS ARE#10 SELF-TAPPING PANCAKE-HEAD,UNLESS .? y NOTED OTHERWISE IN THE DETAILS. DESIGN CRITERIA, O '� F d v�N A. 2015 INTER NATIONAL BUILDING CODE � a B. ASCE 7-10,MINIMUM DESIGN LOADS FOR BUILDINGS AND OTHER STRUCTURES C. SERVICEABILITY AND DEFLECTION CRITERIA PER GOVERNING COMPONENT DESIGN STANDARD D. AISI S100-16,NORTH AMERICAN SPECIFICATION FOR THE DESIGN OF COLD- FORMED STEEL STRUCTURAL MEMBERS AND AISI S220-15 DESIGN LOADING: A. DEAD LOAD: SELF-WEIGHT S••1 B. LIVE LOADS-PARTITION: 5 PSF HORIZONTAL[GOVERNS] N C. WIND LOADING: WA Q� D. FLOOD DESIGN DATA: N/A E. DESIGN LOAD-BEARING VALUES OF SOIL: N/A •r•I F. SEISMIC LOADING(DESIGN CATEGORY AND CLASS) 1. RISK CATEGORY:II 2. SITE CLASS:D rT, 3. SEISMIC IMPORTANCE FACTOR(Ip): 1.0 F+i 4. DESIGN SPECTRAL RESPONSE ACCELERATION PARAMETERS: a. S. 2.Og(WORST CASE DESIGN USED FOR SYSTEM) SUBMITTALS: RCKW5.5 KNEEWALL (6)#12SCREWS 8114' $ CONNECTOR 3l4' 3' 3" 1112' A. THE FOLLOWING SUBMITTALS ARE REQUIRED:COLD-FORMED STUD,CLIPS, SCREWS,AND ANCHORAGE. W 0-- O O-0 IZ O s"s I I W6x8.5 Z Q p€ Q O POST-INSTALLED ANCHOR REQUIREMENTS: O O O O O I Z aCL Of�0 A. USE SIMPSON TITEN HD HEAVY-DUTY SCREW ANCHORS-ZINC PLATED. c I 0 O B. INSTALLATION SHALL CONFORM TO THE MANUFACTURER'S PUBLISHED O O O O O y INSTALLATION INSTRUCTIONS.WHERE HOLES ARE DRILLED IN CONCRETE, I a (n 4 Q HOLES SHALL BE ACCURATELY AND SQUARELY DRILLED,AND THE HOLES __J _ __ S Z U U SHALL BE CLEANED IN ACCORDANCE WITH THE MANUFACTURER'S ``��rrYY 0 Z Z RECOMMENDATIONS. 53 C. UNLESS OTHERWISE NOTED,ANCHORS SHALL BE INSTALLED IN HOLES I g w in F- DRILLED INTO BASE MATERIALS USING CARBIDE-TIPPED DRILL BITS 3/16 S �' 0 Z CONFORMING TO ANSI 3212.154W. ; F IJ.I y D. WHERE MANUFACTURER RECOMMENDS USE OF SPECIAL TOOLS FOR NOTES: $ z m 314"PL 8.25x5' 9116-B w INSTALLATION OF ANCHORS,SUCH TOOLS SHALL BE USED,UNLESS 1. FRAMING AND ANCHORAGE NOT SHOWN FOR CLARITY. $p J �J OTHERWISE PERMITTED SPECIFICALLY BY THE ENGINEER OR ARCHITECT 2. SCREW PATTERN 31S AS SHOWN IN DETAIL.DO NOT DEVIATE. TYP.EA. d U Q a OF RECORD. 3. CONNECTOR SHALL BE CENTERED ON WALL FRAMING. 3/16 FLANGE E. IDENTIFY POSITION OF REINFORCING STEEL AND OTHER EMBEDDED ITEMS PRIOR TO DRILLING HOLES FOR ANCHORS,EXERCISE CARE IN DRILLING TO FFF AVOID DAMAGING EXISTING REINFORCING OR EMBEDDED ITEMS.NOTIFY y THE ENGINEER IF REINFORCING STEEL OR OTHER EMBEDDED ITEMS ARE ee ENCOUNTERED DURING DRILLING. ¢ Z F. SPECIAL INSPECTION:FOR MECHANICAL ANCHORS QUALIFIED FOR USE IN ©SIMPSON RCKW5.5 FASTENING O BASE PLATE P co CRACKED AND UNCRACKED CONCRETE IN ACCORDANCE WITH ICG-ES 6'=V-O" W=1'-O" 6 AC193,PERIODIC SPECIAL INSPECTION IS REQUIRED. Lo W C) Q N LL SECTION 054000-COLD-FORMED METAL FRAMING , U' S'D uW PART 1-PRODUCTS E4 Z L=L 1.1 COLD-FORMED STEEL FRAMING,GENERAL: 98-i14' A. ASTM A 10031A 1003M,STRUCTURAL GRADE,TYPE H,METALLIC COATED,OF W6x8.5 � 0) (/) GRADE AND COATING WEIGHT G40(MIN.). ICK WOOD TOP OF COL SHIM �- Z O B. STEEL STUDS:MANUFACTURER'S STANDARD C-SHAPED STEEL STUDS,OF WEB W6x8.5 � W N H- w J DEPTHS INDICATED,PUNCHED,WITH STIFFENED FLANGES,AND AS FOLLOWS: _ w I�C7 i. MINIMUM BASE-METAL THICKNESS:0.0329 INCH. A992 y H U Z Z 2. MINIMUM FLANGE WIDTH:1.518 INCHES. ALUMINUM DOOR w ��<n 1)-J ~ C. STEEL TRACK:MANUFACTURER'S STANDARD U-SHAPED STEEL TRACK,OF WEB 600T125-33 TRACKS SIDE JAMB 5 O CD vJMQ w w DEPTHS INDICATED.UNPUNCHED,WITH STRAIGHT FLANGES,AND AS OF POST.FASTEN W(2) 5.1tj E a y FOLLOWS: ROWS OF FASTENERS @ #14 SELF-DRILLING 1. MINIMUM BASE-METAL THICKNESS:MATCHING STEEL STUDS. 1Y O.C.STAGGERED FLAT HEAD SCREW g 2. MINIMUM FLANGE WIDTH:1-114INCHES. WITH WINGS-TYPE 1 1.2 FABRICATION 410 STAINLESS A. FABRICATE COLD-FORMED STEEL FRAMING AND ACCESSORIES PLUMB, GYPSUM BOARD LENGTH=&114" (DOOR) N SQUARE,AND TRUE TO LINE,AND WITH CONNECTIONS SECURELY FASTENED, i ACCORDING TO REFERENCED AISI'S SPECIFICATIONS AND STANDARDS,AND EXIST.4" - 3 �'0 s MANUFACTURER'S WRITTEN INSTRUCTIONS. MIN.CONC. � �O B. FABRICATION TOLERANCES:FABRICATE ASSEMBLIES LEVEL,PLUMB,AND TRUE SLAB S.1 TO LINE TO A MAXIMUM ALLOWABLE TOLERANCE VARIATION OF 1/81NCH IN 10 NOTE: BASE PLATE P FEET AND AS FOLLOWS: INSTALL(4)#14 SCREWS AT HEADER g `� 1. SPACING:SPACE INDIVIDUAL FRAMING MEMBERS NO MORE THAN ROUGH OPENING 8 3; SPACED 1'FROM TOP AND 1.5"ON CENTER, 0' 3 PLUS OR MINUS 118EXCEED MI NI FROM PLAN LOCATION.CUMULATIVE ERROR PER DOOR MFR SHALL NOT EXCEED MINIMUM FASTENING REQUIREMENTS OF FASTEN REMAINING SCREWS(�24"O.C. E TOP OF SLAB MAX.SPACING SHEATHING OR OTHER FINISHING MATERIALS. p - off 2. SQUARENESS:FABRICATE EACH COLD-FORMED STEEL FRAMING SIMPSON TITEN HID .i ASSEMBLY TO A MAXIMUM OUT-OF-SQUARE TOLERANCE OF 1/8 INCH. 1l2 x4 :2PART 2-EXECUTION 2.1 EXAMINATION: 0 A. EXAMINE SUPPORTING SUBSTRATES AND ABUTTING STRUCTURAL FRAMING SLIDING DOOR TO POST CONNECTION TYP.SLIDING DOOR POST a 6 FOR COMPLIANCE WIT , 3' 1'H REQUIREMENTS FOR INSTALLATION TOLERANCES AND SO O „ OTHER CONDITIONS AFFECTING PERFORMANCE OF THE WORK.PROCEED = -0" 3/4"=1.4. $€ ($7 WITH INSTALLATION ONLY AFTER UNSATISFACTORY CONDITIONS HAVE BEEN CORRECTED. 2.2 INSTALLATION,GENERAL: A. COLD-FORMED STEEL FRAMING MAY BE SHOP OR FIELD FABRICATED FOR N INSTALLATION,OR IT MAY BE FIELD ASSEMBLED. 6DOT12533 33KSI B. INSTALL COLD-FORMED STEEL FRAMING ACCORDING TO AISI S200 AND TO (1)#10 ( ) CONT.TRACK MANUFACTURER'S WRITTEN INSTRUCTIONS UNLESS MORE STRINGENT FASTEN TRACKS wl#10 @ FACE G REQUIREMEI4B ARE INDICATED. w C. INSTALL SHOP-OR FIELD-FABRICATED,COLD-FORMED FRAMING AND EACH FACE @ 12'O.C. SECURELY ANCHOR TO SUPPORTING STRUCTURE. AND 3"FROM ENDS D. INSTALL COLD-FORMED STEEL FRAMING AND ACCESSORIES PLUMB,SQUARE, FASTEN HEADER GYP.SHEATHING AND TRUE TO LINE,AND WITH CONNECTIONS SECURELY FASTENED. TO COLUMN CAP BOX HEADER wl BOTH SIDES E. INSTALL FRAMING MEMBERS IN ONE-PIECE LENGTHS UNLESS SPLICE wl(4)#10[2 EACH (2)6WS162-33 STUDS AND CONNECTIONS ARE INDICATED FOR TRACK OR TENSION MEMBERS. SIDE OF COLUMN (2)SDOT12533 TRACKS F. INSTALL TEMPORARY BRACING AND SUPPORTS TO SECURE FRAMING AND WEB] g Ci SUPPORT LOADS COMPARABLE IN INTENSITY TO THOSE FOR WHICH F z m STRUCTURE WAS DESIGNED.MAINTAIN BRACES AND SUPPORTS IN PLACE, ? F• UNDISTURBED,UNTIL ENTIRE INTEGRATED SUPPORTING STRUCTURE HAS ' w c FASTEN TRACK o m w BEEN COMPLETED AND PERMANENT CONNECTIONS TO FRAMING ARE TO COLUMN =4 SECURED. %G. DO NOT BRIDGE BUILDING EXPANSION JOINTS WITH COLD-FORMED STEEL USING(/)#10 BOOS162-33(33KSI) O z U FRAMING.INDEPENDENTLY FRAME BOTH SIDES OF JOINTS. [2 EACH SIDE[ STUDS N 16'RC O.C. 0534 H. FASTEN HOLE REINFORCING PLATE OVER WEB PENETRATIONS THAT EXCEED SIMPSON RCKW5.5 wl SIZE OF MANUFACTURER'S APPROVED OR STANDARD PUNCHED OPENINGS. 6 FASTENER PATTERN 2.3 REPAIRS: 6GOT126M[33KSI]CAP S. 3 @ STUD A. PROVIDE FINAL PROTECTION AND MAINTAIN CONDITIONS,INA MANNER ON TOP OF COLUMN 600T125-33(33KSI) ARLINGTON,WA ACCEPTABLE TO MANUFACTURER AND INSTALLER,THAT ENSURE THAT COLD. LENGTH=6'CENTERED 6OT1 TRACK FORMED STEEL FRAMING IS WITHOUT DAMAGE OR DETERIORATION AT TIME OF SUBSTANTIAL COMPLETION, TTw&8.5 A992 SAFEWAY EXIST.4' SIMPSON TITEN HD CONC.SLAB 112-0 @ CLIP SLIDING DOOR HEADER TO POST ®CONNECTION 0 WALL SECTION si 1 1/2"=1'-0" 3/4 Gt�I 0 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington • 18204 59th Ave NE • Arlington, WA 98223 • Phone (360) 403-3551 The following minimum information is required for your Commercial/Multi-Family Building Permit Application. Mark each box to designate that the information has been provided. Please submit this checklist as part of your submittal documents. Incomplete applications will delay the review. 12 One (1) City of Arlington CommercialiMulti-Family Permit Application (One (1) permit application per building or structure is required) 12 One (1) City of Arlington Commercial/Multi-Family Submittal Requirements Form Two (2) Architectural Drawings ❑ Two (2) Structural Drawings ❑ Two (2) Structural Calculations One (1) Project Specification Manuals (if applicable) ❑ One (1) NREC Code Compliance Forms ❑ One (1) Special Inspection Requirements Forms ❑ One (1) Occupant's Statement of Intended Use Form Drawings shall be BOUND SEPARATELY BY TYPE, architectural, structural and landscape, and then ROLLED TOGETHER IN COMPLETE SETS> An intake appointment is required for all new Commercial or Multi-Family Building Permit Applications. To schedule an appointment please contact the City of Arlington Permit Center at (360) 403 3551 or by email to ced@arlingtonwa.gov. acknowledge that all items designated above are included as part of this application. REV 2015 Page 1 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington• 18204 59th Ave NE• Arlington, WA 98223• Phone(360) 403-3551 A. FEES DUE AT TIME OF PERMIT ISSUANCE B. CODES The City of Arlington currently enforces the following: International Codes 1. 2015 International Building Code (IBC) 2. 2015 International Residential Code (IRC) 3. 2015 International Mechanical Code (IMC) 4. 2015 International Fuel Gas Code(IFGC) 5. 2015 International Fire Code(IFC) 6. 2015 International Plumbing Code(I PC) 7. 2015 International Property Maintenance Code(IPMC) 8. 2015 International Existing Property Code (IEBC) 9. 2015 Washington State Energy Code (WESC) 10. 2009 Accessible& Usable Buildings and Facilities(ICC/ANSI 1417.1) Washington State Amendments 1. WAC 51-50 Washington State Building Code 2. WAC 51-51 Washington State Residential Code 3. WAC 51-52 Washington State Mechanical Code 4. WAC 51-54 Washington State Fire Code 5. WAC 51-56&51-57 Washington State Plumbing Code and Standards 6. WAC 51-11 Washington State Energy Code 7. WAC 296-46B Electrical Safety Standards, Administration, and Installation C. CITY OF ARLINGTON DESIGN REQUIREMENTS Design Wind Speed: 85 miles per hour(Exposure C) Ground Snow Load: 25 pounds per square foot Seismic Zone: D2 Rainfall: 2 inches per hour for roof drainage design. Frost Line Depth: 12 inches Soil Bearing Capacity: 1,500 psf unless a Geo-Technical Report is provided. (IBC Table 1804.2&IRC R401.4.1) D. PLANS AND DRAWINGS Submit two(2) complete sets of drawings and plans. Drawings and plans must be submitted on minimum 18"X 24", or maximum 30"X 42"paper.All sheets are to be the same size and sequentially labeled. Plans are required to be clearly legible,with scaled dimensions, in indelible ink, blue line,or other professional media. Plans will not be accepted that are marked preliminary or not for construction,that have red lines,cut and paste details or those that have been altered after the design professional has signed the plans. Please Note:A separate submittal of plans is required for each building or structure. REV 2015 Page 2 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington • 18204 59th Ave NE • Arlington, WA 98223 • Phone(360) 403-3551 DETAILED SUBMITTAL REQUIREMENTS Mark each box to designate that the information has been provided. Please submit this checklist as part of your submittal documents A. SITE PLAN —,REQUIRED WITH ALL SUBMITTALS (May be included as part of the Architectural Drawing cover Sheet) 1. Drawing shall be prepared at scale not to exceed 1"=20 feet. 2. Show building outline and all exterior improvements. 3. Provide property legal description and show property lines. 4. Provide dimensions from the property lines to a minimum of two building corners (or two identifiable locations for irregular plan shapes). 5. Show building setbacks, easements and street access locations. 6. Indicate North direction. 7. Indicate finish floor elevation for the first level. 8. Provide topographical map of the existing grades and the proposed finished grades with maximum five feet elevation contour lines. 9. Show the location of all existing underground utilities, including water,sewer,gas and electrical. 10. Flood hazard areas,floodways,and design flood elevations as applicable. B. ARCHITECTURAL DRAWINGS 1. Cover Sheet a) Building Information 1. Specify model code information. 2. Construction Type. 3. Number of stories and total height in feet. 4. Building square footage(per floor and total) 5. IBC Occupancy Type (show all types by floor and total). 6. Mixed-use ratio (if applicable) 7. Occupant load calculation (show by occupancy type and total) 8. List work to be performed under this permit b) Design Team Information 1. Design Professional in Responsible Charge 2. Architects 3. Structural Engineers 4. Owner 5. Developer 6. Any other Design Team Members 2. Floor Plan a) Plan view 1/8°minimum scale. Details a minimum %.-inch scale. b) Plans must show the entire tenant space. c) Specify the use of each room/area. d) Provide an occupant load calculation on the floor plan. (on every floor, in all rooms and spaces) e) Show ALL exits on the plans;include new,existing or eliminated. f) Show Barrier-Free information on the drawings. g) Show the location of all permanent rooms,walls and shafts. h) Note the uses in the adjacent tenant spaces, if applicable. i) Provide a door and door hardware schedule. REV 2015 Page 3 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington• 18204 59th Ave NE• Arlington, WA 98223• Phone(360) 403-3551 j) Show the location of all new walls, doors,windows, etc. k) Provide details and assembly numbers for any fire resistive assemblies. 1) Indicate on the plans all rated walls,doors, windows and penetrations. m) Provide a legend that distinguishes existing walls, walls to be removed and new walls. 3. ❑ Reflected Ceiling Plan a) Plan view 1/8"minimum scale. Details a minimum %4-inch scale. b) Provide ceiling construction details. c) Provide suspended ceiling details complying with IBC 803.9.1.1. Show seismic bracing details. d) Show the location of all emergency lighting and exit signage. e) Detail the seismic bracing of the fixtures. f) Include a lighting fixture schedule. 4. Framing Plan a) Specify the size, spacing, span and wood species or metal gage for all stud walls. b) Indicate all wall, beam and floor connections. c) Detail the seismic bracing for all walls. d) Include a stair section showing rise, run, landings, headroom, handrail and guardrail dimensions. 5. ❑ Storage Racks (if applicable) a) Structural calculations are required for seismic bracing of storage racks eight feet or greater in height. b) Eight feet or less,show a positive connection to floor or walls. NOTE:High pile storage shall meet the requirements of current International Building and Fire Codes. C. ❑ SPECIAL INSPECTION 1. Where special inspection is required by IBC 1704, the registered design professional in responsible charge shall prepare a special inspection program that will be submitted to the City of Arlington and approved prior to issuance of the building permit to comply with IBC 106.1. D. ❑ WASHINGTON STATE ENERGY CODE 1.One (1)completed Washington State Non-Residential Energy Code Envelope Summary forms. E. OCCUPANT'S STATEMENT OF INTENDED USE 1. The Occupant's Statement of Intended Use form shall be completely filled out and may require the submittal of a Hazardous Materials inventory Statement(HMIS). Contact the Arlington REV 2015 Page 4 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington • 18204 59th Ave NE • Arlington, WA 98223 • Phone (360) 403-3551 The building permit does not include any mechanical, electrical, plumbing or fire sprinkler'alarm work. These permits are issued separately. Mechanical, electrical, plumbing, or fire sprinkler°alarm permits require a separate permit application and may also require separate plan review. Please note that any tenant improvement work in a space that involves food handling or preparation requires Snohomish County Health District approval before the permit can be issued. You must provide the Permit Center a copy of the approval letter or the approved plans. Contact the Snohomish County Health District at (425) 339-5250 with any questions or for more information. An intake appointment is required for all large Tenant Improvement Building Permit Applications. To determine if your project requires an intake appointment, to schedule an appointment or to ensure that you have the most current information, please contact the City of Arlington Permit Center at (360) 403-3551 or by email to ced@arlingtonwa.gov. Incomplete applications will not be accepted. I acknowledge that all items designated as submittal requirements must accompany my Building Permit Application to be considered a complete submittal. REV 2015 Page 5 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington• 18204 59th Ave NE• Arlington, WA 98223• Phone(360) 403-3551 THIS APPLICATION TO BE USED FOR NEW COMMERCIAL STRUCTURES AND RESIDENTIAL DWELLINGS NOT REGULATED UNDER THE IRC. THIS APPLICATION MUST BE ACCOMPANIED BY COMMERCIAL APPLICATION SUBMITTAL CHECKLIST AND AN OCCUPANT'S STATEMENT OF INTENDED USE. Name of Project:Safeway #534 - Grocery Staging Area Valuation: $40,000 Project Address: 3532 172nd St., Arlington WA 98223 Parcel ID#: 31052800200100 Legal Description 3532 172ND ST NE , ARLINGTON, WA 98223- Owner: SAFEWAY INC Phone Number: 206.391.6631 Address: 1371 OAKLAND BLVD STE 200 City: WALNUT CREEK State:CA Zip Code:94596 Engineer:Architect - Dale Ulmer Phone Number: 407-661-9100 Cell Phone: E-mail: 1925 Prospect Ave Orlando FL 32814 Address: p City: State: Zip Code: General Contractor:TBD Phone Number:TBD Cell Phone: TBD E-mail: TBD Address:TBD City:TBD State: TBD Zip Code:TBD Contractor's License Number:TBD Expiration:TBD Contact Person: Ernestina Lobo Phone Number: 407-661-9100 x2826 Cell Phone: 407-738-2998 E-mail: ErnestinaL@c-p.com Address: 1925 Prospect Ave City:Orlando State: FIL Zip Code: 32814 Proposed Scope of Work:Interior remodel to provide a grocery staging area for the short term hold of online REV 2015 Page 6 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington • 18204 59th Ave NE • Arlington, WA 98223 • Phone(360) 403-3551 Project Name/Tenant Safeway #534 - Grocery Staging Area Site Address3532 172nd St., Arlington WA 98223 Bldg/Unit/Suite IBC Construction Type 11113 IBC Occupancy Type Mercantile Description of Use Grocery Building Square Footage 55891 Number of Stories 1 Square Footage Per Floor Will there be any installation, modification or removal of the following? (Check all that apply) ❑ Automatic fire extinguishing systems ❑ Compressed gas systems ❑ Fire alarm and detection systems ❑ Fire pumps ❑ Flammable and combustible liquids (tanks,piping etc...) ❑ Hazardous materials ❑ High piled/rack storage ❑ Industrial ovens/furnace ❑ Private fire hydrants ❑ Spraying or dipping operations ❑ Standpipe systems ❑ Temporary membrane structure, tents (>200sq ft)or canopies (>400 sq ft) Provide details on any of the above checked items: Installation,changes, modifications or removal of any of the above may require additional submittals, information, or permits during the plan review or construction process. Statement of Special Inspection REV 2015 Page 7 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington• 18204 59th Ave NE• Arlington, WA 98223• Phone(360) 403-3551 Name of Project: Project Address: Special Inspection Firm: Address: Contact Person: Phone: Email: Special Inspection Firm Special Inspectors: The Special inspection Firm of will perform special inspection for the following types of work(separate forms must be submitted if more than one firm is to be employed). ( ) Reinforced Concrete ( ) Bolting in Concrete ( ) Pre-stressed Concrete ( ) Shotcrete ( ) Structural Masonry ( ) Structural Steel and Welding ( ) High-Strength Bolting ( ) Spray-Applied Fireproofing ( ) Smoke-Control Systems ( ) Other Specify: All individual inspectors to be employed on this project will be WABO certified for the type of inspection they are to perform. If inspection is for work that is not covered by the WABO categories,a detailed resume of the inspector and firm must be submitted.The resume must show the inspector and firm are qualified to perform the work and testing required by the project design and specifications. The work shall be inspected for conformance with the plans and specifications approved by the City. Revisions and addenda sheets will not be used for inspection unless approved by the City.The special inspector shall report to the City revisions that are not approved. A daily record will be maintained on site itemizing the inspections performed,for the review of all parties.Any nonconforming items shall be brought to the immediate attention of the contractor for resolution. A weekly shall be submitted to the City;detailing the inspections and testing performed, listing any nonconforming items and resolution of nonconforming items. Unresolved nonconforming items will be detailed on a discrepancy report and presented to the building department. A final report shall be submitted to the Building Division prior to the Certificate of Occupancy being issued. This report will indicate that inspection and testing was completed in conformance with the approved plans,specifications and approved revisions and addenda. Any unresolved discrepancies must be detailed in the final report. The special inspector and special inspection firm serve in the role as"deputy"City of Arlington inspectors and as such are responsible to the City of Arlington Building Division in the performance of the required work. Contractor: The contractor shall provide the special inspector or agency adequate notification of work requiring inspection. The City approved plans and specifications must be made available, at the job site for the use of the special inspector and the City Inspector. The contractor shall maintain all daily inspections reports, on site,for review. REV 2015 Page 8 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington• 18204 59th Ave NE• Arlington, WA 98223• Phone(360) 403-3551 The special inspection functions are considered to be in addition to the normal inspections performed by the City and the contractor is responsible for contacting the City to schedule regular inspections. No concrete shall be poured or other work covered until approved by the City Inspector. Building Division: The Building Division shall review any revisions and addenda. Approved copies will be given to the contractor to maintain as part of the approved plan set. The City Inspector will monitor the special inspection functions for compliance with the agreement and the approved plans. The City Inspector shall be responsible for approving various stages of construction to be covered and work to proceed. Design Professionals: The architect and engineer will clearly indicate on the plans and specifications for the specific types of special inspection required, and shall include a schedule for inspection and testing. The architect and engineer will coordinate their revisions and addenda process in such a way as to insure all required City approvals are obtained, prior to work shown on the revisions being performed. Owner: The project owner, or the architect or engineer acting as the owners agent, shall employ the special inspector or agency. ENFORCEMENT: A failure of the special inspector or firm to perform in keeping the requirements of the IBC,the approved plans and this document may void this agreement and the Building Officials approval of the special inspector. In such case a new special inspector and/or firm would need to be proposed for approval.A failure of the design and/or construction parties to perform in accordance with this agreement may result in a STOP WORK notice being posted on the project, until nonconforming items have been resolved. ACKNOWLEDGEMENTS I have read and agree to comply with the terms and conditions of this agreement. Owner: Date: I hereby certify that the above information is correct and that the construction on, and the occupancy and the use of the above-described property will be in accordance with the laws, rules and regulation of the State of Washington. ���C.�te'OtCrcCL°CyGO� Applicants Signature Ernestina Lobo July 26, 2018 Print Applicants Name Date FOR STAFF USE ONLY Permit# Accepted By Amount Received Receipt# Date Received REV 2015 Page 9 of 9 Project Quantity Item# Lawson#26247 Model Specified: CSI Section 11400 G-Series Reach-In Refrigerators/ One,Two &Three Section Models, 32" Deep Self-Contained G Aside from their anodized aluminum side and interior finishes, EquTraulsen's G-Series "Dealer's Choice" models meet or exceed the easy with an _ SERIES standard specifications and performance of most other brands top easy to use 0 0 o microprocessor III I tier product offerings. Reliable,energy efficient,and durable,with control! Stainless Steel Front&000resl large individual storage capacities,the high quality G-Series line- up includes a wide range of one,two and three section reach-in refrigerator and freezer models,built in our most popular footprints. They are available with either full or half height doors,and the added convenience of a variety of different door hingings to choose from. In addition,each also includes a number of user-friendly features, making them one of the best overall equipment values in Foodservice Model G20010 today,and the right fit for nearly any commercial application. Model G10010 AVAILABLE MODELS Single Section Two Section Three Section I Model# Door Hinging Model# Door Hinging Model It Door Hinging G10000 Half Right G20000 Half Left-Right G30000 Half Left-Right-Right G10001 Half Left G20001 Half Right-Left G30001 Half Left-Left-Right G10010 Full Right G20002 Half Right-Right G30002 Half Right-Right-Right Model G30010 G10011 Full Left G20003 Half Left-Left G30003 Half Left-Left-Left G20010 Full Left-Right G30010 Full Left-Right-Right G20011 Full Right-Left G30011 Full Left-Left-Right G20012 Full Right-Right G30012 Full Right-Right-Right G20013 Full Left-Left G30013 Full Left-Left-Left Standard Product Features Optional Accessory Kits • High Quality Stainless Steel Exterior Front and Door(s) Additional Epoxy Coated Shelves* • Corrosion Resistant Anodized Aluminum One-Piece Sides No.1 Type Tray Slides*To Accommodate either:(1)18"x • Durable Anodized Aluminum Interior 26"or(2) 14"x 18"Sheet Pans,Adjustable To 2"O.C. • Microprocessor Control With LEDTemperature Readout No.4TypeTray Slides*To Accommodate(1)18"x 26"Sheet • Top-Mounted,Balanced,Self-Contained Refrigeration System Pans(equips one full section) • Large High Humidity Evaporator Coil Outside The Food Zone Universal Type Tray Slides*To Accommodate Either(1) 18"x • Load-Sure Guard Protects Against Improper Loading 26"or(2) 14"x 18"Sheet Pans,or(2) 12"x 20"Steam Table • Full or Half Length Stainless Steel Doors With Locks Pans,Adjustable To 4"O.C. • Self-Closing Doors With Stay Open Feature At 120 Degrees Plated Shelves*(for use in lieu of standard shelving) • Guaranteed For Life Cam-Lift Hinges EZ-Change Interiors(#1,universals,universal heavy duty tray • Guaranteed For Life Horizontal Work Flow Door Handle(s) slides and shelves) • Automatically Activated Incandescent Lights 6"High Adjustable Legs(for use in lieu of standard casters) • Damage Resistant Stainless Steel Breaker Caps • Three(3)Adjustable Epoxy Coated Shelves Per Section, *Please refer to spec sheetTR35872 for optional accessory kit details. Supported On Shelf Pins(installed at the factory) • Energy Saving Automatic Non-Electric Condensate Evaporator All optional accessory kits are shipped separately for later installa- • Magnetic Snap-In EZ-Clean Door Gaskets tion by others at the jobsite. • Gasket-Protecting Anodized Aluminum Door Liner • Anti-Condensate Door Perimeter Heaters • Thermostatic Expansion Valve Metering Device Provides Quick * All models are ENERGY STAR'listed. Please refer Refrigeration Recovery Times E to www.energystargov to view the most up-to-date • Stainless Steel One-Piece Louver Assembly ffL7JFMX Mi, product listing and performance data. • 9'Cord&Plug Attached • Set of Four(4)6"High Casters With Locks • Three Year Parts And Labor Warranty Listed by Underwriters Laboratories Inc., • Five Year r PaCompressor Warrant D UL US NSF to U.S.and Canadian safety standards and Y Listed by NSF International. LISTED _R WARRANTY Approval: TRAULSEN lam„ -•PHONE]1 BLUE:��• • •• • WORTH, .6 • Project Quantity Item# Model Specified: CSI Section 11400 Specifications Construction,Hardware and Insulation Refrigeration System Cabinet exterior front, louver assembly and doors are constructed of 20 gauge A top mounted, self-contained, balanced refrigeration system using R-134a stainless steel.Cabinet sides (including returns), interior and door liners are refrigerant is conveniently located behind the one piece louver assembly. It features constructed of anodized aluminum.The exterior cabinet top,back and bottom are an easy to clean front facing condenser,thermostatic expansion valve,air-cooled constructed of heavy gauge aluminized steel.A set of four(4)6"high casters are hermetic compressor,large,high humidity evaporator coil located outside the food included. zone and a top mounted non-electric condensate evaporator. A 9'cord and plug is Doors are equipped with a gasket protecting metal door pan, removable plug provided.Standard operating temperature is34to38°F. cylinder locks and guaranteed for life cam-lift,gravity action,self-closing metal, Controller glide hinges with stay open feature at 120 degrees. Hinges include a concealed The easy to use water resistant microprocessor control system is supplied standard. switch to automatically activate the interior incandescent lighting.Guaranteed for It includes a 3-Digit LED Display,and a Fahrenheit or Celsius Temperature Scale life,work flow door handles are mounted horizontally over recess in door which limits Display Capability. protrusion from door face into aisleways. Interior Gasket profile and Santoprene®material simplify cleaning and increase overall gasket Standard interior arrangements include three(3)epoxy coated wire shelves per life.Anti condensate heaters are located behind each door opening. section,mounted on shelf pins,installed at the factory. Shelves are full-width,and Both the cabinet and door(s)are insulated with an average of 2"thick high density, do not have any large gaps between them requiring the use of"bridge"or"junior non-CFC,foamed in place polyurethane. shelves." Recommended load limit per shelf should not exceed 225 lbs. Warranties DIMENSIONAL DATA 1-Section Models 2-Section Models 3-Section Models Both a three year parts and labor warranty and a five year compressor warranty(self- Net capacity cu.ft. 24.2(686 cu 1) 46.0(1303 cu 1) 69.1(1958 cu 1) contained models only)are provided standard. Length-overall in. 29%(75.9 cm) 521/8(132.4 cm) 761/,6(193.8 cm) Depth-overall in. 35(88.8 cm) 35(88.8 cm) 35(88.8 cm) , • Depth-over body in. 32(81.3 cm) 32(81.3 cm) 32(81.3 cm) Depth-door open 90°in. 57%(146.3 cm) 57%(146.3 cm) 57%(146.3 cm) Clear door width in. 21'/8(53.6 cm) 21'/8(53.6 cm) 21'/8(53.6 cm) Clear half-door height in. 27Yz(69.9 cm) 27Yz(69.9 cm) 27Yz(69.9 cm) Clear full-door height in. 57%(146.3 cm) 57%(146.3 cm) 57%(146.3 cm) Height-overall on 6"casters' 831/4(211.5 cm) 831/4(211.5 cm) 831/4(211.5 cm) No.Standard Shelves 3 6 9 Shelf area sq.ft.' 18.8(1.75 sq m) 34.6(3.21 sq m) 51.9(4.82 sq m) ELECTRICAL DATA Elevation Elevation Elevation Voltage 115/60/1 115/60/1 115/60/1 One-Section Two-Section Three-Section Feed wires with Ground 3 3 3 Full load amperes 5.8 7.4 8.4 REFRIGERATION DATA Refrigerant R-134a R-134a R-134a 24[75.9cm] BTU/HR H.P.z 1520('/s HP) 2240('/3 HP) 4610(%HP) I [�54[132.4cm]� 24�[63.2cm] I II SHIPPING DATA Length-crated in. 35(89 cm) 63(160 cm) 91(231 cm) eX 47J[119.7cm] E Depth-crated in. 43(109 cm) 43(109 cm) 43(109 cm) Height-crated in. 831h(212 cm) 831h(212 cm) 831/2(212 cm) Volume-crated cu.ft. 71(2011 cu 1) 131(3711 cu 1) 189(5354 cu 1) 211[53.6cm] Net Wt.lbs. 305(138 kg) 450(204 kg) 610(277 kg) Gross Wt.lbs. 395(179 kg) 590(268 kg) 790(358 kg) \ LI:3bcm] NOTES z PLCS.nP. NOTE:Figures in parentheses reflect metric equivalents. 1= Figure shown reflects the area of standard shelf compliment plus the additional storage area available on Plan-One-Section Plan-Two-Section the cabinet bottom. 2= Based on a 90 degree F ambient and 20 degree F evaporator. For remote data please refer to spec sheetTR35837. 3= 12"Top clearance preferred for optimum performance and service access. 35"(88.8 cm) r-32"(81.3 cm))l 76&[193.8cm] 6 71A[181.Icm] I I -- 211[53.6cm] n u E Equipped With One NEMA 5-15 P Plug 3 PLCS.1YP. inm fvu • � m Hie � NOTE:When ordering please specify:Voltage,Hinging,Door Size,Options and any additional warranties. Plan-Three-Section Continued product development may necessitate specification changes without notice. Section-All Models Part No.TR35787(revised 7/13) TRAULSEN 4401 BLUE MOUNDWORTH, 06 PHONE :111 6 1 Project Quantity Item#Lawson 54326 Model Specified: CSI Section 11400 G-Series Hinged Glass Door Reach-In One &Two Section Models, 32" Deep Freezers/Self-Contained Aside from their anodized aluminum side and interior finishes, GTraulsen's G-Series"Dealer's Choice" models meet or exceed the Equipped with an sERiEs standard specifications and performance of most other brands top tier easy to use product offerings. Reliable,energy efficient,and durable,with large 0 0 0 microprocessor / p g gy g control! I Stainless Steel Front 8 Door(s) individual storage capacities,the high quality G-Series line-up includes a wide range of one and two section reach-in freezer models,built in our most popular footprints. They are available with full height doors. In addition,each also includes a number of user-friendly features, making them one of the best overall equipment values in Foodservice today,and the right fit for nearly any commercial application. V, AVAILABLE MODELS Single Section Two Section Model# Door Hinging Model# Door Hingina G13010-023 Full Right G23010-023 Full Left-Right G13011-023 Full Left Model G13010-023 (shown with right-right hinging) Standard Product Features Optional Accessory Kits • High Quality Stainless Steel Exterior Front • Additional Epoxy Coated Shelves' • Corrosion Resistant Anodized Aluminum One-Piece Sides • No. 1 Type Tray Slides*To Accommodate either: (1) 18"x • Durable Anodized Aluminum Interior 26"or(2) 14"x 18"Sheet Pans,Adjustable To 2"O.C. • Microprocessor Control With LED Temperature Readout No.4 Type Tray Slides*To Accommodate (1) 18"x 26"Sheet • Top-Mounted, Balanced, Self-Contained Refrigeration System Pans(equips one full section) • Large High Humidity Evaporator Coil Outside The Food Zone Universal Type Tray Slides To Accommodate Either(1) 18"x • Load-Sure Guard Protects Against Improper Loading 26"or(2) 14"x 18"Sheet Pans, or(2) 12"x 20"Steam Table • Full Length Hinged Glass Doors With Locks Pans,Adjustable To 4"O.C. • Self-Closing Doors With Stay Open Feature At 120 Degrees • Plated Shelves*(for use in lieu of standard shelving) • Guaranteed For Life Cam-Lift Hinges • EZ-Change Interiors (#1, universals, universal heavy duty • Stainless Steel Vertical Door Handle(s) tray slides and shelves) • LED Lights With Exterior Switch 6" High Adjustable Legs(for use in lieu of standard casters) • Damage Resistant Stainless Steel Breaker Caps • Three(3)Adjustable Epoxy Coated Shelves Per Section, 'Please refer to spec sheet TR35872 for optional accessory kit details. Supported On Shelf Pins (installed at the factory) • Energy Saving Automatic Non-Electric Condensate Evaporator All optional accessory kits are shipped separately for later installation by • Magnetic Snap-In EZ-Clean Door Gaskets others at the jobsite. • Anti-Condensate Door Perimeter Heaters Many Traulsen models are EPA Energy Star listed. Please refer • Thermostatic Expansion Valve Metering Device Provides Quick = to www.energystar.gov to view the most up-to-date product listing Refrigeration Recovery Times ff—wrmffmi- and performance data. • Stainless Steel One-Piece Louver Assembly • 9'Cord & Plug Attached • Set of Four(4)6" High Casters With Locks ON �S NSF, • Three Year Parts And Labor Warranty = • Five Year Compressor Warranty Intertek This unit is listed to UL 471,CSA 120 and NSF by an approved NRTL. Consult the factory or unit data plate for approval information. 3,,,_-'YIEAIR.• Approval: TRAULSEN lam„ITI H•PHONE1 BLUE:•�• • •• • WORTH, 6. • Project Quantity Item# Model Specified: CSI Section 11400 Specifications Construction,Hardware and Insulation Refrigeration System Cabinet exterior front and louver assembly are constructed of 20 gauge stainless A top mounted, self-contained, balanced refrigeration system using R-404A steel. Cabinet sides(including returns)and interior are constructed of anodized refrigerant is conveniently located behind the one piece louver assembly. It features aluminum.The exterior cabinet top,back and bottom are constructed of heavy gauge an easy to clean front facing condenser,thermostatic expansion valve,air-cooled, aluminized steel.A set of four(4)6"high casters are included. hermetic compressor,large,high humidity evaporator coil located outside the food Doors are equipped with removable plug cylinder locks and guaranteed for life zone and a top mounted non-electric condensate evaporator. A 9'cord and plug is cam-lift,gravity action,self-closing metal,glide hinges with stay open feature at 120 provided. Standard operating temperature is 0 to-5°F(all models are-10 degree F degrees.An exterior mounted switch is provided to operate the interior LED capable in up to 90 degree ambient. lighting. Each door includes a vertically mounted stainless steel handle. Controller Gasket profile and Santoprene®material simplify cleaning and increase overall gasket The easy to use water resistant microprocessor control system is supplied standard. life.Anti condensate heaters are located behind each door opening. It includes a 3-Digit LED Display,and a Fahrenheit or Celsius Temperature Scale The cabinet is insulated with an average of 2"thick high density,non-CFC,foamed Display Capability. in place polyurethane. Interior Standard interior arrangements include three (3)epoxy coated wire shelves per DIMENSIONAL DATA 1-Section Models section,mounted on shelf pins,installed at the factory. Shelves are full-width,and Net capacity cu.ft. 23.4(6631) 46.0(1303 1) do not have any large gaps between them requiring the use of"bridge"or"junior shelves." Recommended load limit per shelf should not exceed 225 lbs. Length-overall in. 29%(75.9 cm) 52'/e(132.4 cm) Warranties Depth-overall in. 35(88.8 cm) 35(88.8 cm) Both a three year parts and labor warranty and a five year compressor warranty Depth-over body in. 32(81.3 cm) 32(81.3 cm) (self-contained models only)are provided standard. Depth-door open 90'in. 57%(146.3 cm) 57%(146.3 cm) Clear door width in. 21'/(53.6 cm) 21'/(53.6 cm) Clear half-door height in. 27Y2(69.9 cm) 27Y2(69.9 cm) Clear full-door height in. 57%(146.3 cm) 57%(146.3 cm) Height-overall on 6"casters' 83%(211.5 cm) 83%(211.5 cm) 1758.8 cm] No.Standard Shelves 3 6 -s2,/e"n32.<=ml- 24 J/8'•1631.8 cm] Shelf area sq.ft.' 18.8(1.75 sq m) 34.6(3.21 sq m) ELECTRICAL DATA T Tae,/e n22z.4=ml Voltage 115/60/1 115/60/1 _ 27lsas.a=ml V m 27lbas.a=m] F Feed wires with Ground 3 3 N Full load amperes 9.7 11.2 L REFRIGERATION DATA z,ve Isa.e=mi 2,ua"Isa.e oml " Refrigerant R-404A R-404A BTU/HR H.P.2 1500(Y22 HP) 2970(%HP) SHIPPING DATA - as las.8 cm 32"1812.E cml Length-crated in. 35(89 cm) 63(160 cm) Depth-crated in. 43(109 cm) 43(109 cm) Height-crated in. 83Y22(212 cm) 83Y22(212 cm) Volume-crated cu.ft. 71 (2011 cu 1) 131(3711 cu 1) E Net Wt.lbs. 320(145 kg) 650(295 kg) Gross Wt.lbs. 410(186 kg) 700(318 kg) E E NOTES � - NOTE:Figures in parentheses reflect metric equivalents. , 1=Figure shown reflects the area of standard shelf compliment plus the additional storage area available " on the cabinet bottom. " 2=Based on a 90 degree F ambient and 20 degree F evaporator.For remote data please refer to spec sheet TR35837. 3=12"Top clearance preferred for optimum performance and service access. Equipped With One NEM o (one&two section models only NOTE:When ordering please specify:Voltage,Hinging,Door Size and Options. Continued product development may necessitate specification changes without notice. Part No.TR36020(REV.06-26-17) PHONETRAULSEN 4401 BLUE MOUND RD. FT WORTH,TX 76106 :rr r r Lawson # 54686 BESAM SL500 1/4„ 41/2" PRELIMINARY RELEASE A%AABUN OVERHEAD CONCEALED FULL BREAKOUT (6.3) 1114.31 ❑R APPROVAL NARROW STILE SINGLE SLIDE DOOR SYSTEM COVER SIDE e o SECTION SHOP DRAWING APPROVAL O SIGNATURE: BREAK❑UT SIDE 4-1/2"(114.3) SECTION M.O.H. 0 ELECTRICAL SERVICE O 2444,7) C20 HEADER DATE 3 2] o � I 120 VAC, 50/60 V NOTE: BY SIGNING THIS SHOP DRAWING, THE CUSTOMER IS APPROVING THE CUSTOM DOOR 15/20A. BY ELEC, C❑NTR, CONFIGURATION FOR FABRICATION AS DRAWN, TO JUNCTION BOX.--] UNIT DESCRIPTION 1 4 BESAM SL500-❑HC-NS (1-REQ'D) FULL BREAKOUT SINGLE SLIDING DOOR SYSTEMS MOTION/PRESENCE O.F.H. NARROW STILE DOORS-LEFT HAND SLIDE SURFACE o u SENSORS 96N MOUNTED TRACK ' SLIDING DOOR SYSTEM " (2438.4) t I I PACKAGE SHALL INCLUDE AUTOMATIC OPERATOR, COVER SIDE DOORS, SIDELITES, VERTICAL WEATHER STRIPPING, STD, EMERGENCY BREAKAWAY, STANDARD 1-P❑INT LOCK, O.F.H. BREAKOUT SIDE 5-POSITION SWITCH-KNOB, VERTICAL JAMB TUBES 96" « HEIGHT AND MOTION & PRESENCE SENSOR, C2438,4) 86-7/8' PACKAGE SHALL ALSO INCLUDE; (2206.6) PIN GUIDE ON SURFACE MOUNTED TRACK, KEY CYLINDER (EXTERI❑R) / THUMBTURN (INTERIOR), L4 REPLACEABLE CORE CYLINDER, LOCK INDICATOR, SECTION CONCEALED SWEEP A/L & S/L, 10" BOTTOM RAILS, MAGNETIC CATCH, 2 2 HD CARRIER WHEELS, NON REMOVABLE SECURITY SWITCH, DOOR P❑SITI❑N SWITCH, 3 SECURITY TYPE 10" GUIDETRACK 1/4" x 6" THRESHOLD —JAMB TO JAMB, GLAZING BEAD RAIL SURF, MTD, 1/4"(6.3) GLASS STOPS, Z_F.F.L. SYSTEM (1/4") (STANDARD) 1/4'(6.3) CLEAR TEMPERED GLASS. 10" BOTTOM RAIL F.F.L. 0 1/4• (I)ONE—YEAR WARRANTY ON PARTS AND LABOR, EXTERIOR ELEVATION I NOTES LEFT HAND SINGLE SLIDE-NS ALL THRESHOLDS 1. ALUMINUM FINISH TO BE DARK BRONZE ANODIZED, FIELD LOCATED 5/8" INTERIOR BY INSTALLER (15.8) 2. ELECTRICAL SERVICE AND ALL HARD WIRING TO BE SUPPLIED BY ELECTRICAL CONTRACTOR. 84-1/2" ROUGH OPENING WIDTH 4-1/2" 3. PREPARATION OF OPENINGS TO ACCEPT PACKAGES, Factory Prep (114.3) SHALL BE BY OTHERS, Switch Location 84" OVERALL FRAME WIDTH 4. CAULKING -STANDARD COLORS ONLY, BY AAES. @ 74-1/2"H 1/4" (6.3) 5. THESE PACKAGES WILL BE ORDERED AND BUILT IN PIVOT 41-1/2" ACTIVE LEAF ACCORDANCE TO THESE APPROVED SHOP DRAWINGS. P❑INT 1- 6. WITH THE APPROVAL OF THESE SHOP DRAWINGS, 3/4" ' a-aie THE G.C. IS GUARANTEEING TO HOLD REQUIRED (44.4) I FIELD DIMENSIONS. m 7. ALL WRITTEN DIMENSIONS SHALL TAKE PREFERENCE TRACK OVER SCALED DIMENSIONS, GUIDEQHOLD OPEN 4-1/2" 8. SUPPORT AT HEADER FOR OPERATOR IS BY OTHERS. ®OFF (114,3) ®EXIT ONLY —— (9)2-WAY (FULL OPENING) A COVER SIDE (5)2—WAY (AUTO. PARTIAL OPENING) + CUSTOMER; SAFEWAY NATIONAL DA WORK _t_tFILE NAME. SAFEWAY—LH � 35-1/4" 41-1/2" SIDELITE CLEAR DOOR OPENING DDO NOT RAWING DATE: DWG. BY. DDD SCALE E THIS DRAWING SECTION INTERLOCK �d / / i / �3 EXTERIOR ENGAGED (TYP). — L.H.SLIDE SAFEWAY PLAN LEFT HAND SLIDE EXTERIOR A%A ABWY SHEET 1 OF 1 Lawson # 54214 for 4' Kit 54215 for 8' Kit 54216 for 12' Kit I DROP-IN-SHELF DL425N NOTES: MAXIMUM NUMBER OF TOTES PER SECTION: 15 TOTES FOR 4' 30 TOTES FOR 8' 45 TOTES FOR 12' FINISHES: METAL-PLT,PLATINUM BACKS-PLT,PLATINUM DIMS: 72"H X 4'W X 25"D ALB E RTSO N'S FOR DESIGN INTENT ONLY..ENGINEERING IS REQUIRED PRIOR TO FABRICATION. Llr�� ©2018 DOZIER CORPORATION.THIS DRAWING IS THE EXCLUSIVE PROPERTY OF THE LOZIER J DRIVE UP AND GO STORAGE ALB008 CPD 03.02.2018 CORPORATION AND IS FOR THE SOLE USE OF THE CUSTOMER FOR WHOM IT IS INTENDED. Gt�I 0 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington • 18204 59th Ave NE • Arlington, WA 98223 • Phone (360) 403-3551 The following minimum information is required for your Commercial/Multi-Family Building Permit Application. Mark each box to designate that the information has been provided. Please submit this checklist as part of your submittal documents. Incomplete applications will delay the review. 12 One (1) City of Arlington CommercialiMulti-Family Permit Application (One (1) permit application per building or structure is required) 12 One (1) City of Arlington Commercial/Multi-Family Submittal Requirements Form Two (2) Architectural Drawings ❑ Two (2) Structural Drawings ❑ Two (2) Structural Calculations One (1) Project Specification Manuals (if applicable) ❑ One (1) NREC Code Compliance Forms ❑ One (1) Special Inspection Requirements Forms ❑ One (1) Occupant's Statement of Intended Use Form Drawings shall be BOUND SEPARATELY BY TYPE, architectural, structural and landscape, and then ROLLED TOGETHER IN COMPLETE SETS> An intake appointment is required for all new Commercial or Multi-Family Building Permit Applications. To schedule an appointment please contact the City of Arlington Permit Center at (360) 403 3551 or by email to ced@arlingtonwa.gov. acknowledge that all items designated above are included as part of this application. REV 2015 Page 1 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington• 18204 59th Ave NE• Arlington, WA 98223• Phone(360) 403-3551 A. FEES DUE AT TIME OF PERMIT ISSUANCE B. CODES The City of Arlington currently enforces the following: International Codes 1. 2015 International Building Code (IBC) 2. 2015 International Residential Code (IRC) 3. 2015 International Mechanical Code (IMC) 4. 2015 International Fuel Gas Code(IFGC) 5. 2015 International Fire Code(IFC) 6. 2015 International Plumbing Code(I PC) 7. 2015 International Property Maintenance Code(IPMC) 8. 2015 International Existing Property Code (IEBC) 9. 2015 Washington State Energy Code (WESC) 10. 2009 Accessible& Usable Buildings and Facilities(ICC/ANSI 1417.1) Washington State Amendments 1. WAC 51-50 Washington State Building Code 2. WAC 51-51 Washington State Residential Code 3. WAC 51-52 Washington State Mechanical Code 4. WAC 51-54 Washington State Fire Code 5. WAC 51-56&51-57 Washington State Plumbing Code and Standards 6. WAC 51-11 Washington State Energy Code 7. WAC 296-46B Electrical Safety Standards, Administration, and Installation C. CITY OF ARLINGTON DESIGN REQUIREMENTS Design Wind Speed: 85 miles per hour(Exposure C) Ground Snow Load: 25 pounds per square foot Seismic Zone: D2 Rainfall: 2 inches per hour for roof drainage design. Frost Line Depth: 12 inches Soil Bearing Capacity: 1,500 psf unless a Geo-Technical Report is provided. (IBC Table 1804.2&IRC R401.4.1) D. PLANS AND DRAWINGS Submit two(2) complete sets of drawings and plans. Drawings and plans must be submitted on minimum 18"X 24", or maximum 30"X 42"paper.All sheets are to be the same size and sequentially labeled. Plans are required to be clearly legible,with scaled dimensions, in indelible ink, blue line,or other professional media. Plans will not be accepted that are marked preliminary or not for construction,that have red lines,cut and paste details or those that have been altered after the design professional has signed the plans. Please Note:A separate submittal of plans is required for each building or structure. REV 2015 Page 2 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington • 18204 59th Ave NE • Arlington, WA 98223 • Phone(360) 403-3551 DETAILED SUBMITTAL REQUIREMENTS Mark each box to designate that the information has been provided. Please submit this checklist as part of your submittal documents A. SITE PLAN —,REQUIRED WITH ALL SUBMITTALS (May be included as part of the Architectural Drawing cover Sheet) 1. Drawing shall be prepared at scale not to exceed 1"=20 feet. 2. Show building outline and all exterior improvements. 3. Provide property legal description and show property lines. 4. Provide dimensions from the property lines to a minimum of two building corners (or two identifiable locations for irregular plan shapes). 5. Show building setbacks, easements and street access locations. 6. Indicate North direction. 7. Indicate finish floor elevation for the first level. 8. Provide topographical map of the existing grades and the proposed finished grades with maximum five feet elevation contour lines. 9. Show the location of all existing underground utilities, including water,sewer,gas and electrical. 10. Flood hazard areas,floodways,and design flood elevations as applicable. B. ARCHITECTURAL DRAWINGS 1. Cover Sheet a) Building Information 1. Specify model code information. 2. Construction Type. 3. Number of stories and total height in feet. 4. Building square footage(per floor and total) 5. IBC Occupancy Type (show all types by floor and total). 6. Mixed-use ratio (if applicable) 7. Occupant load calculation (show by occupancy type and total) 8. List work to be performed under this permit b) Design Team Information 1. Design Professional in Responsible Charge 2. Architects 3. Structural Engineers 4. Owner 5. Developer 6. Any other Design Team Members 2. Floor Plan a) Plan view 1/8°minimum scale. Details a minimum %.-inch scale. b) Plans must show the entire tenant space. c) Specify the use of each room/area. d) Provide an occupant load calculation on the floor plan. (on every floor, in all rooms and spaces) e) Show ALL exits on the plans;include new,existing or eliminated. f) Show Barrier-Free information on the drawings. g) Show the location of all permanent rooms,walls and shafts. h) Note the uses in the adjacent tenant spaces, if applicable. i) Provide a door and door hardware schedule. REV 2015 Page 3 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington• 18204 59th Ave NE• Arlington, WA 98223• Phone(360) 403-3551 j) Show the location of all new walls, doors,windows, etc. k) Provide details and assembly numbers for any fire resistive assemblies. 1) Indicate on the plans all rated walls,doors, windows and penetrations. m) Provide a legend that distinguishes existing walls, walls to be removed and new walls. 3. ❑ Reflected Ceiling Plan a) Plan view 1/8"minimum scale. Details a minimum %4-inch scale. b) Provide ceiling construction details. c) Provide suspended ceiling details complying with IBC 803.9.1.1. Show seismic bracing details. d) Show the location of all emergency lighting and exit signage. e) Detail the seismic bracing of the fixtures. f) Include a lighting fixture schedule. 4. Framing Plan a) Specify the size, spacing, span and wood species or metal gage for all stud walls. b) Indicate all wall, beam and floor connections. c) Detail the seismic bracing for all walls. d) Include a stair section showing rise, run, landings, headroom, handrail and guardrail dimensions. 5. ❑ Storage Racks (if applicable) a) Structural calculations are required for seismic bracing of storage racks eight feet or greater in height. b) Eight feet or less,show a positive connection to floor or walls. NOTE:High pile storage shall meet the requirements of current International Building and Fire Codes. C. ❑ SPECIAL INSPECTION 1. Where special inspection is required by IBC 1704, the registered design professional in responsible charge shall prepare a special inspection program that will be submitted to the City of Arlington and approved prior to issuance of the building permit to comply with IBC 106.1. D. ❑ WASHINGTON STATE ENERGY CODE 1.One (1)completed Washington State Non-Residential Energy Code Envelope Summary forms. E. OCCUPANT'S STATEMENT OF INTENDED USE 1. The Occupant's Statement of Intended Use form shall be completely filled out and may require the submittal of a Hazardous Materials inventory Statement(HMIS). Contact the Arlington REV 2015 Page 4 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington • 18204 59th Ave NE • Arlington, WA 98223 • Phone (360) 403-3551 The building permit does not include any mechanical, electrical, plumbing or fire sprinkler'alarm work. These permits are issued separately. Mechanical, electrical, plumbing, or fire sprinkler°alarm permits require a separate permit application and may also require separate plan review. Please note that any tenant improvement work in a space that involves food handling or preparation requires Snohomish County Health District approval before the permit can be issued. You must provide the Permit Center a copy of the approval letter or the approved plans. Contact the Snohomish County Health District at (425) 339-5250 with any questions or for more information. An intake appointment is required for all large Tenant Improvement Building Permit Applications. To determine if your project requires an intake appointment, to schedule an appointment or to ensure that you have the most current information, please contact the City of Arlington Permit Center at (360) 403-3551 or by email to ced@arlingtonwa.gov. Incomplete applications will not be accepted. I acknowledge that all items designated as submittal requirements must accompany my Building Permit Application to be considered a complete submittal. REV 2015 Page 5 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington• 18204 59th Ave NE• Arlington, WA 98223• Phone(360) 403-3551 THIS APPLICATION TO BE USED FOR NEW COMMERCIAL STRUCTURES AND RESIDENTIAL DWELLINGS NOT REGULATED UNDER THE IRC. THIS APPLICATION MUST BE ACCOMPANIED BY COMMERCIAL APPLICATION SUBMITTAL CHECKLIST AND AN OCCUPANT'S STATEMENT OF INTENDED USE. Name of Project:Safeway #1522 - Grocery Staging Area Valuation: $40,000 Project Address: 20500 Olympic Place, Arlington, WA 98223 Parcel ID#: 00847300000800 Legal Description 20500 Olympic Place, Arlington, WA 98223 Owner: Safeway, Inc. Phone Number: 206.391.6631 Address: 1371 Oakland Blvd., Suite 200 City:Walnut Creek State:CA Zip Code:94596 Engineer:Architect - Dale Ulmer Phone Number: 407-661-9100 Cell Phone: E-mail: 1925 Prospect Ave Orlando FL 32814 Address: p City: State: Zip Code: General Contractor:TBD Phone Number:TBD Cell Phone: TBD E-mail: TBD Address:TBD City:TBD State: TBD Zip Code:TBD Contractor's License Number:TBD Expiration:TBD Contact Person: Ernestina Lobo Phone Number: 407-661-9100 x2826 Cell Phone: 407-738-2998 E-mail: ErnestinaL@c-p.com Address: 1925 Prospect Ave City:Orlando State: FIL Zip Code: 32814 Proposed Scope of Work:Interior remodel to provide a grocery staging area for the short term hold of online REV 2015 Page 6 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington • 18204 59th Ave NE • Arlington, WA 98223 • Phone(360) 403-3551 Project Name'Tenant Safeway #1522 - Grocery Staging Area Site Address20500 Olympic Place, Arlington, WA 98223 Bldg/Unit/Suite IBC Construction Type 11113 IBC Occupancy Type Mercantile Description of Use Grocery Building Square Footage 43096 Number of Stories 1 Square Footage Per Floor Will there be any installation, modification or removal of the following? (Check all that apply) ❑ Automatic fire extinguishing systems ❑ Compressed gas systems ❑ Fire alarm and detection systems ❑ Fire pumps ❑ Flammable and combustible liquids (tanks,piping etc...) ❑ Hazardous materials ❑ High piled/rack storage ❑ Industrial ovens/furnace ❑ Private fire hydrants ❑ Spraying or dipping operations ❑ Standpipe systems ❑ Temporary membrane structure, tents (>200sq ft)or canopies (>400 sq ft) Provide details on any of the above checked items: Installation,changes, modifications or removal of any of the above may require additional submittals, information, or permits during the plan review or construction process. Statement of Special Inspection REV 2015 Page 7 of 9 COMMERCIAL APPLICATION f � o� PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington• 18204 59th Ave NE• Arlington, WA 98223• Phone(360) 403-3551 Safeway #1522 - Grocery Staging Area Name of Project: Project Address: 20500 Olympic Place, Arlington, WA 98223 Special Inspection Firm: TBD Address: Contact Person: Phone: Email: Special Inspection Firm Special Inspectors: The Special inspection Firm of will perform special inspection for the following types of work(separate forms must be submitted if more than one firm is to be employed). ( ) Reinforced Concrete ( ) Bolting in Concrete ( ) Pre-stressed Concrete ( ) Shotcrete ( ) Structural Masonry ( ) Structural Steel and Welding ( ) High-Strength Bolting ( ) Spray-Applied Fireproofing ( ) Smoke-Control Systems ( ) Other Specify: All individual inspectors to be employed on this project will be WABO certified for the type of inspection they are to perform. If inspection is for work that is not covered by the WABO categories,a detailed resume of the inspector and firm must be submitted.The resume must show the inspector and firm are qualified to perform the work and testing required by the project design and specifications. The work shall be inspected for conformance with the plans and specifications approved by the City. Revisions and addenda sheets will not be used for inspection unless approved by the City.The special inspector shall report to the City revisions that are not approved. A daily record will be maintained on site itemizing the inspections performed,for the review of all parties.Any nonconforming items shall be brought to the immediate attention of the contractor for resolution. A weekly shall be submitted to the City;detailing the inspections and testing performed, listing any nonconforming items and resolution of nonconforming items. Unresolved nonconforming items will be detailed on a discrepancy report and presented to the building department. A final report shall be submitted to the Building Division prior to the Certificate of Occupancy being issued. This report will indicate that inspection and testing was completed in conformance with the approved plans,specifications and approved revisions and addenda. Any unresolved discrepancies must be detailed in the final report. The special inspector and special inspection firm serve in the role as"deputy"City of Arlington inspectors and as such are responsible to the City of Arlington Building Division in the performance of the required work. Contractor: The contractor shall provide the special inspector or agency adequate notification of work requiring inspection. The City approved plans and specifications must be made available, at the job site for the use of the special inspector and the City Inspector. The contractor shall maintain all daily inspections reports, on site,for review. REV 2015 Page 8 of 9 COMMERCIAL APPLICATION PERMIT SUBMITTAL Department of Community & Economic Development City of Arlington• 18204 59th Ave NE• Arlington, WA 98223• Phone(360) 403-3551 The special inspection functions are considered to be in addition to the normal inspections performed by the City and the contractor is responsible for contacting the City to schedule regular inspections. No concrete shall be poured or other work covered until approved by the City Inspector. Building Division: The Building Division shall review any revisions and addenda. Approved copies will be given to the contractor to maintain as part of the approved plan set. The City Inspector will monitor the special inspection functions for compliance with the agreement and the approved plans. The City Inspector shall be responsible for approving various stages of construction to be covered and work to proceed. Design Professionals: The architect and engineer will clearly indicate on the plans and specifications for the specific types of special inspection required, and shall include a schedule for inspection and testing. The architect and engineer will coordinate their revisions and addenda process in such a way as to insure all required City approvals are obtained, prior to work shown on the revisions being performed. Owner: The project owner, or the architect or engineer acting as the owners agent, shall employ the special inspector or agency. ENFORCEMENT: A failure of the special inspector or firm to perform in keeping the requirements of the IBC,the approved plans and this document may void this agreement and the Building Officials approval of the special inspector. In such case a new special inspector and/or firm would need to be proposed for approval.A failure of the design and/or construction parties to perform in accordance with this agreement may result in a STOP WORK notice being posted on the project, until nonconforming items have been resolved. ACKNOWLEDGEMENTS I have read and agree to comply with the terms and conditions of this agreement. Owner: Date: I hereby certify that the above information is correct and that the construction on, and the occupancy and the use of the above-described property will be in accordance with the laws, rules and regulation of the State of Washington. ���C.�te'OtCrcCL°CyGO� Applicants Signature Ernestina Lobo July 27, 2018 Print Applicants Name Date FOR STAFF USE ONLY Permit# Accepted By Amount Received Receipt# Date Received REV 2015 Page 9 of 9